(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFC

CP001509.YBFC        Location/Qualifiers
FT   CDS_pept        693173..693742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfC"
FT                   /locus_tag="ECD_00661"
FT                   /product="putative secreted protein"
FT                   /note="similar to b0704"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42537"
FT                   /protein_id="ACT42537.1"
FT                   /translation="MKRVLFFLLMIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPV
FT                   LNNKAMWRWYQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQ
FT                   ELINTAEKTAFLGDRFRSYIRAGIYQKKSSDPAQLLAVLDNSIMVKYFKEEKPTYARMT
FT                   AHLPNKDESYECLTKIQHELLRSEEK"
     atgaaaagag ttttgttctt tttgctgatg atatttgtta gttttggtgt tatagctgat        60
     tgcgaaatac aagctaaaga tcatgattgt tttactattt tcgctaaggg tactattttt       120
     tccgcgtttc ctgtcttaaa taataaagcc atgtggagat ggtatcagaa tgaggacatc       180
     ggtgagtatt attggcaaac agaactgggc acatgtaaaa ataataaatt cacaccaagc       240
     ggggcgagac tcttaattcg cgttgggtca ctacgcctta atgaaaatca tgccatcaaa       300
     ggaacgttgc aggagttgat aaatacagca gaaaaaacgg cgtttctcgg cgatcggttt       360
     agaagttata taagagcggg tatctatcaa aaaaagagca gtgatccagc tcagttgttg       420
     gcagtccttg ataattcaat catggttaaa tattttaaag aagagaagcc aacttatgct       480
     cgaatgacag cacatctccc gaacaaagat gagtcttacg aatgtttaac aaaaatacag       540
     catgaactgc ttcgtagtga agaaaaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page