(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFE

CP001509.YBFE        Location/Qualifiers
FT   CDS_pept        complement(671479..671772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECD_00642"
FT                   /product="LexA-regulated protein, CopB family"
FT                   /note="similar to b0685"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42518"
FT                   /protein_id="ACT42518.1"
FT                   /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRD
FT                   KVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV"
     atggccaaag aacaaacgga ccgtacgaca ttagatctgt tcgcgcacga gcgtcgaccg        60
     ggacgaccga aaactaatcc gctttcgcgc gatgaacagc tgcgtattaa taaacgcaac       120
     caactaaaac gcgacaaagt acgtggcctt aagcgtgtcg aactgaagct gaacgcggaa       180
     gctgtcgagg cgctgaacga gctggcggaa tcgcgcaata tgagccgtag cgaactgatc       240
     gaagagatgt taatgcagca actggcggcg ctgcgtagtc agggcatcgt ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page