(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFGH

CP001509.YBFGH       Location/Qualifiers
FT   CDS_pept        complement(675821..676471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfGH"
FT                   /locus_tag="ECD_00647"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0690-b0691"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42523"
FT                   /protein_id="ACT42523.1"
FT                   /translation="MREMNQLVNTEDSAWPIIQNWLKDATNHTELLPVNKDLAETALYQ
FT                   LQVTTKSPMGALVYGSGGLLIDNGWLRIAGSGHPRLPRDPVSWTQRPEFAGVRALPIAD
FT                   DVAGGIFALNGGDLGEDTGCVYYFAPDTLNWESLEVGYSEFLQWALSGDLDTFYENVRW
FT                   QQWREDVIKLSATEAFTFYPFLWVQSEEARTRKVISLTELWEMQYQMKETFTQ"
     atgcgtgaaa tgaatcagtt agtaaatact gaagattcag cctggccaat aatccagaac        60
     tggttaaaag acgccacaaa ccataccgaa ctcttaccgg ttaataaaga tttagccgaa       120
     accgcacttt atcaattaca ggtgacaaca aaatcaccga tgggtgcgct tgtctatggc       180
     tccggaggtc tgctgattga taatggttgg ttacgcatag caggatctgg tcacccccgg       240
     ttgccacgag atccagtaag ttggacacaa cgccctgaat tcgcaggcgt gcgggcttta       300
     cccatcgctg acgatgtcgc agggggaatt tttgctctta atggtggcga tcttggggaa       360
     gatactggct gcgtttatta ttttgcgcca gatacgctga attgggaaag tctggaagtt       420
     ggatattctg agtttcttca gtgggcatta tccggtgatt tagatacctt ctatgaaaat       480
     gtacgatggc agcaatggcg agaagacgta ataaaattat cggcaacgga agccttcacg       540
     ttctaccctt tcttatgggt acaaagtgaa gaagcaagaa caagaaaagt tatttcgctt       600
     actgaactct gggaaatgca gtatcaaatg aaagaaacat tcacgcaata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page