(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGA

CP001509.YBGA        Location/Qualifiers
FT   CDS_pept        697673..698182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="ECD_00667"
FT                   /product="DUF1722 family protein"
FT                   /note="similar to b0707"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42542"
FT                   /protein_id="ACT42542.1"
FT                   /translation="MNQQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDFYNQYYQRVIVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
     atgaatcagc aacgatttga tgacagcacc ctaatccgta tcttcgccct tcatgagtta        60
     catcgactga aagaacatgg cttaacgcgc ggggcgcttc tcgattatca cagccgctat       120
     aaactcgtct ttctggcgca ttctcagccg gagtaccgca aacttggccc gttcgtggct       180
     gatattcacc agtggcaaaa tctggatgat ttttacaacc agtactacca acgcgtaatt       240
     gttttgcttt ctcatcccgc caacccgcgc gatcacacca acgttttgat gcacgttcag       300
     ggttattttc gcccgcatat tgattccaca gaacgccagc agttggcggc gcttatcgac       360
     agttatcgcc gtggcgagca accacttctt gcgccgctga tgcgtatcaa acactatatg       420
     gcgctttatc ctgacgcctg gctttcaggg cagcgttatt tcgaactttg gccgcgtgtg       480
     attaacttgc gccattcagg agttttatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page