(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGD

CP001509.YBGD        Location/Qualifiers
FT   CDS_pept        complement(710799..711365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="ECD_00679"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0719"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00679"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42554"
FT                   /protein_id="ACT42554.1"
FT                   /translation="MFKGQKTLTALAISLLFTAPVYAADEGSGEIHFKGEVIEAPCEIH
FT                   QDDIDKEVELGQVTTSHINQSHHSDAVAVDLRLVNCDLENSSNGSGGKISKVAVTFDSS
FT                   AKTTGADPILNNTSTGEATGVGVRLMNKDQSNIVLGTATPDIDLAPTSSEQTLNFFAWM
FT                   EQIDQATPVTPGAVTANATYVLDYK"
     atgtttaaag gacaaaaaac attgaccgct ctggccatat ctctgctatt cactgcacct        60
     gtttatgcag ctgatgaagg atccggtgaa attcacttta aaggtgaagt tattgaagca       120
     ccgtgtgaaa tacatcagga tgatattgat aaagaggttg aactcggtca ggtgaccacc       180
     agccacatta atcagtcaca tcacagcgat gccgttgctg tcgacctgcg cttagtcaac       240
     tgtgatctgg aaaactccag caacggttcc ggtggcaaga tttctaaagt tgcagtcacc       300
     tttgatagct cagcgaaaac caccggcgca gatccgattc tcaacaacac cagcacgggt       360
     gaagccaccg gcgtcggcgt acgtttaatg aataaagatc aaagcaatat cgttttaggc       420
     accgctactc cagatatcga cctggctccg acctccagcg aacaaacgct gaatttcttt       480
     gcctggatgg aacaaattga tcaggctaca cctgtaacgc caggcgcagt tacagcgaat       540
     gcgacctacg tgctggatta taaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page