(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGF

CP001509.YBGF        Location/Qualifiers
FT   CDS_pept        738259..739050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="ECD_00702"
FT                   /product="periplasmic TolA-binding protein"
FT                   /note="similar to b0742"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00702"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42577"
FT                   /protein_id="ACT42577.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSSDQSGAAASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
     atgagcagta acttcagaca tcaactattg agtctgtcgt tactggttgg tatagcggcc        60
     ccctgggccg cttttgctca ggcaccaatc agtagtgtcg gctcaggctc ggtcgaagac       120
     cgcgtcactc aacttgagcg tatttctaat gctcacagcc agcttttaac ccaactccag       180
     caacaacttt ctgataatca atccgatatt gattccctgc gtggtcagat tcaggaaaat       240
     cagtatcaac tgaatcaggt cgtggagcgg caaaagcaga tcctgttgca gatcgacagc       300
     ctcagcagcg gtggtgcagc ggcgcaatca accagcagcg atcaaagcgg tgcggcggca       360
     tcaacgacgc cgacagctga tgctggtact gcgaatgctg gcgcgccggt gaaaagcggc       420
     gatgcaaaca cggattacaa tgcagctatt gcgctggtgc aggataaatc ccgccaggat       480
     gacgcaatgg tggcatttca gaatttcatc aaaaattacc ctgattcaac ttacctgcca       540
     aacgccaatt attggctggg tcagttaaac tacaacaagg gtaaaaaaga tgatgcggcg       600
     tactattttg cttcggtagt gaaaaactat ccgaagtcac caaaggctgc tgatgcgatg       660
     tttaaagtcg gcgtcatcat gcaggacaaa ggtgacaccg caaaagcgaa agccgtatac       720
     cagcaggtta tcagtaaata ccctggtact gatggcgcta aacaggcaca aaaacgtctg       780
     aacgcgatgt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page