(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGI

CP001509.YBGI        Location/Qualifiers
FT   CDS_pept        701391..702134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="ECD_00670"
FT                   /product="NIF3 family metal-binding protein"
FT                   /note="similar to b0710"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42545"
FT                   /protein_id="ACT42545.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAC
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
     atgaaaaaca ccgaactgga acaactgatt aacgaaaaac tgaacagcgc ggcgattagt        60
     gattacgcgc cgaatggttt gcaggtggaa ggcaaagaga cggtgcaaaa aattgttacc       120
     ggtgtcaccg cctgccaggc tttgctcgat gaggcagtgc gtctgggcgc ggatgcggtc       180
     attgtgcatc atggctactt ctggaaagga gagtctccgg tcattcgcgg aatgaagcgt       240
     aaccgtttaa aaacgttgct ggcgaatgat atcaacctgt atggctggca tttgccgctt       300
     gacgcacatc ctgagctggg caataacgca cagctggcgg cgttactggg gatcacggtc       360
     atgggcgaaa ttgagccgtt ggtgccgtgg ggagagctga ccatgcctgt gccgggactg       420
     gagctggctt cctggattga agcgcgtctg ggacgtaagc cgttatggtg tggcgatacc       480
     ggacctgagg tggtccagcg cgtcgcctgg tgcacgggcg gcgggcaaag ttttatcgat       540
     agcgccgcgc gttttggcgt ggatgctttt attactggcg aagtttctga acagaccatt       600
     cattcagccc gcgagcaggg attgcatttt tatgctgcag gtcaccatgc cactgaacgt       660
     ggtggtattc gcgcattgag cgagtggctg aatgaaaata ccgatcttga tgtgaccttt       720
     attgatattc ctaatcctgc ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page