(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGL

CP001509.YBGL        Location/Qualifiers
FT   CDS_pept        703729..704463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="ECD_00673"
FT                   /product="UPF0271 family protein"
FT                   /note="similar to b0713"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00673"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42548"
FT                   /protein_id="ACT42548.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQPGALIENEEQALAQTLEMVQHGRVKSITGEWATVTAQTVCLHGDGE
FT                   HALAFARRLRSTFAEKEIVVAA"
     atgaaaattg acctgaacgc cgatctgggc gaaggctgcg ccagcgacgc agagctatta        60
     acgctggttt cctctgccaa tattgcttgt ggatttcatg caggcgatgc ccaaaccatg       120
     caggcttgcg tgcgtgaagc aataaaaaat ggtgtcgcga ttggcgctca cccgagtttt       180
     cccgacaggg aaaattttgg tcgcagcgcc atgcagctgc cgccagaaac cgtttacgcc       240
     cagacgctgt atcaaattgg cgcgctggca acgattgccc gtgcgcaagg cggcgtaatg       300
     cgtcatgtca aaccgcacgg catgttgtac aaccaggcgg cgaaagaagc acaactggca       360
     gacgccatcg ccagagcggt atacgcttgc gatccggcat tgattctcgt tgggctggca       420
     ggaagcgagc tgattcgtgc aggcaagcaa tatggcctga caacgcgcga ggaagtgttt       480
     gccgatcgcg gttatcaggc tgacggctcg ctggtgccgc gaagtcagcc aggcgcgttg       540
     attgaaaacg aagaacaggc gctggcgcaa acgctagaga tggtgcaaca cggcagagtc       600
     aaaagtatca ccggcgaatg ggcaacggtc acggcgcaaa cagtctgcct gcatggcgac       660
     ggcgagcacg cactggcgtt cgcccgccga ctacgctcta catttgccga aaaggagatt       720
     gttgtcgcag cataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page