(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGO

CP001509.YBGO        Location/Qualifiers
FT   CDS_pept        complement(706485..707546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="ECD_00676"
FT                   /product="putative fimbrial protein"
FT                   /note="similar to b0716"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00676"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42551"
FT                   /protein_id="ACT42551.1"
FT                   /translation="MSAGKGVLLVICLLFLPLKSALALNCYFGSSGGSVEKSEVIQPFA
FT                   VPGNAKPGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGVQDRYYQLGVTYNG
FT                   VDYDANQGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKICSGDPANIHMSRTFLARMR
FT                   LYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLENIRVLDCSVNF
FT                   SISPETQMIDFGKFNLLDIRRHNMTKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEE
FT                   DKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLIYEKTYTAELSSIAGTPIEAG
FT                   PFDTVVLFKINYN"
     atgagtgctg gcaagggagt gttgctcgtc atctgtctgt tatttctgcc gttgaagtct        60
     gcgcttgccc tgaactgcta ctttggttca tccggtggtt cggtagaaaa atcagaagtg       120
     attcaacctt ttgctgtacc aggcaatgcc aaacccggcg ataagatttg ggaatctgac       180
     gatattaaaa ttcccgtcta ttgtgacaac aataccaacg gcaactttga aagtgagcat       240
     gtctacgcct gggtaaaccc ctacccgggg gtgcaggatc gctattatca actcggcgta       300
     acttacaatg gcgttgatta tgacgccaac cagggaaaaa gccgcatcga cactaaccag       360
     tgtatcgaca gtaagaacat tgacatttat acccctgagc agatcatcgc gatgggatgg       420
     cagaacaaaa tttgttcggg cgatcccgct aatattcaca tgtcgcgtac ctttctcgct       480
     cgcatgcggt tatacgtcaa aatacgagaa atgccgccgc atgattatca aagtacgctt       540
     agcgactata tcgtcgtgca atttgacggt gccggtagcg ttaacgaaga tcctaccgcc       600
     caaaacctga aatatcatat tactggtctg gaaaacattc gcgtgctgga ttgcagcgtc       660
     aatttttcta tttcaccgga aacacagatg attgattttg gtaaatttaa tttgctggat       720
     attcggcgac ataacatgac gaaaacgttc agtattaaaa cgaccaagag ccaaaacgat       780
     caatgcaccg acggatttaa agtcagttcc tcgttttata ctgaagaaac gttggttgaa       840
     gaagataaag cattgttgat tggtaatggt ctgaagctac gtttgctgga tgaaaacgcc       900
     tcgccttata ccttcaataa atatgctgaa tacgccgatt tcaccagtga catgttgatc       960
     tacgaaaaaa cctatacagc tgaactttcg tccattgcag gtacccccat cgaggctggg      1020
     cccttcgata cagtggtgct ttttaaaatt aactataact ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page