(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGQ

CP001509.YBGQ        Location/Qualifiers
FT   CDS_pept        complement(708289..710739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgQ"
FT                   /locus_tag="ECD_00678"
FT                   /product="putative outer membrane protein"
FT                   /note="similar to b0718"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00678"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42553"
FT                   /protein_id="ACT42553.1"
FT                   /translation="MNIYRLSFVSCLVMAMPCALAVEFNLNVLDKSMRDRIDISLLKEK
FT                   GVIAPGEYFVSVAVNNNQISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQI
FT                   DRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNLF
FT                   ASNYRPQDGSSSTNLNAYGTTGINAGSWRLRSDYQLNNTDSEDSHEQSGGISRTYLFRP
FT                   LPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVT
FT                   ISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQG
FT                   QVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLLSGDDYHSAAMGIGQ
FT                   NMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHS
FT                   YANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAG
FT                   FNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTTHR
FT                   MSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAANDYSSVSS
FT                   SWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSY
FT                   QPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPL
FT                   GADIRQDDSGISVGMVGEEGHAWLSGVAENQKFTVVWGDSQHCSLHLPEHMEDTANRLI
FT                   LPCH"
     gtgaatattt atcgactctc ttttgtatcc tgcctggtca tggcgatgcc ttgcgcattg        60
     gcggtcgaat ttaatctgaa tgttctcgat aaatcaatgc gcgaccgcat tgatatttca       120
     ttattaaagg aaaaaggagt cattgctccc ggtgaatatt ttgttagcgt tgcggtgaat       180
     aacaaccaaa tcagtaatgg gcaaaaaatc aactggcaaa aaaagggtga caaaaccatt       240
     ccatgcatca atgattcact ggtcgataaa tttggtttaa aaccagatat ccgtcagtcc       300
     ttgccacaga tagatcggtg tattgatttc agttcccgac ctgaaatgct cttcaatttc       360
     gatcaagcca atcagcaact gaatattagt attccgcaag cctggctggc gtggcactca       420
     gaaaactggg ctcccccctc tacatggaaa gaaggtgttg ccggggtcct gatggattat       480
     aacctgtttg ccagcaacta ccgcccacag gacggcagca gcagcactaa cctgaacgcc       540
     tacggtacca ccggaattaa cgccgggtca tggcgcttac gcagtgatta ccagcttaat       600
     aacaccgata gcgaagatag ccatgaacag tcaggcggaa tatcgcgcac ctatcttttt       660
     cgtccattac cgcaattagg ctctaaatta accctcggcg aaaccgattt cagttccaat       720
     attttcgatg gtttttctta tactggcgcg gcactggcga gtgacgatcg aatgttgcca       780
     tgggagctac gcggatacgc cccacaaatt agcggtattg cacagaccaa tgccacggtg       840
     acgatcagtc aatcaggtcg cgtcatttac cagaaaaaag tccctccggg accgtttatt       900
     attgatgacc tcaatcagtc tgttcagggc acgcttgatg tcaaagtgac ggaagaagat       960
     ggtcgggtga acaatttcca ggtttcggca gcatcgacgc ccttcctgac tcgtcaggga      1020
     caggttcgct ataaactggc cgcgggtcag ccacggccct ccatgtcaca tcaaactgaa      1080
     aatgaaacct tttttagcaa tgaagtttcc tgggggatgc tgtcaaacac ctcgctgtac      1140
     ggcggcctgc tgctttctgg tgatgactac cattctgccg caatgggtat tgggcaaaat      1200
     atgctgtggc ttggtgcgct gtcgtttgat gtcacgtggg ccagtagcca ttttgatact      1260
     cagcaggacg agcggggctt aagctaccgt tttaattaca gcaaacaagt ggatgccact      1320
     aacagcacga tttccctcgc cgcttatcgt ttctccgatc gtcattttca cagctacgcc      1380
     aactatctgg atcacaaata caacgacagc gatgcgcagg acgaaaaaca gacgatcagc      1440
     ttatctgtgg gccaaccgat taccccacta aacctcaatc tttacgccaa cctgctacat      1500
     caaacctggt ggaatgcaga cgcctccacg accgccaaca tcacggcagg ttttaatgtt      1560
     gatattggtg actggagaga tatctctatt tcgacgtcat tcaatacaac ccattacgaa      1620
     gataaagatc gcgacaacca gatttacctg tcgatttcgc tccccttcgg taacggtggt      1680
     cgggttggct atgacatgca aaacagtagc cacagcacca cacaccgcat gtcgtggaac      1740
     gatacgctgg atgaacgtaa tagctggggc atgtctgccg gactgcaatc cgaccgtcct      1800
     gacaatggag cccaggtgag cggtaactat cagcacctga gttcagcggg tgagtgggat      1860
     atttctggta cctatgccgc caatgattac agttccgtca gcagcagctg gagcggttct      1920
     ttcaccgcaa cccaatatgg tgcagcgttt catcgccgca gctccaccaa tgaaccacgc      1980
     ctgatggtca gcaccgatgg cgtggcagat attccggttc agggcaatct cgactacacc      2040
     aaccattttg gcattgcggt ggtgccgttg atttccagtt accagccttc caccgtggcg      2100
     gtgaacatga atgacttacc cgacggcgta acagttgcag aaaacgttat caaagaaacg      2160
     tggattgaag gcgcgatagg ttacaaatca ctggcttccc gttccggtaa agacgttaac      2220
     gtcatcattc gcaacgccag cggtcagttt cctcccctcg gagcggatat ccgccaggat      2280
     gacagcggca ttagcgtggg gatggttggc gaggaaggac atgcctggtt aagcggagtc      2340
     gctgaaaatc aaaagtttac cgtggtctgg ggtgatagtc agcattgctc gctccatctt      2400
     cctgaacata tggaagacac cgcaaatcgc ctgattttac cttgtcatta a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page