(data stored in ACNUC7421 zone)

EMBL: CP001509.YBHB

CP001509.YBHB        Location/Qualifiers
FT   CDS_pept        complement(791426..791902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhB"
FT                   /locus_tag="ECD_00740"
FT                   /product="kinase inhibitor-like protein, UPF0098 family"
FT                   /note="similar to b0773"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42641"
FT                   /protein_id="ACT42641.1"
FT                   /translation="MKLISNDLRDGDKLPHRHVFNGMGYDGDNISPHLAWDDVPAGTKS
FT                   FVVTCYDPDAPTGSGWWHWVVVNLPADTRVLPQGFGSGLVAMPDGVLQTRTDFGKTGYD
FT                   GAAPPKGETHRYIFTVHALDIERIDVDEGASGAMVGFNVHFHSLASASITAMFS"
     atgaaactca tcagtaacga tctgcgcgat ggcgataaat tgccgcatcg tcatgtcttt        60
     aacggcatgg gttacgatgg cgataatatt tcaccgcatc tggcgtggga tgatgttcct       120
     gcgggaacga aaagttttgt tgtcacctgc tacgacccgg atgcgccaac cggctccggc       180
     tggtggcact gggtagttgt taacttaccc gctgataccc gcgtattacc gcaagggttt       240
     ggctctggtc tggtagcaat gccagacggc gttttgcaga cgcgtaccga ctttggtaaa       300
     accgggtacg atggcgcagc accgccgaaa ggcgaaactc atcgctacat ttttaccgtt       360
     cacgcgctgg atatagaacg tattgatgtc gatgaaggtg ccagcggcgc gatggtcggg       420
     tttaacgttc atttccactc tctggcaagc gcctcgatta ctgcgatgtt tagttaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page