(data stored in ACNUC7421 zone)

EMBL: CP001509.YBHL

CP001509.YBHL        Location/Qualifiers
FT   CDS_pept        803876..804580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhL"
FT                   /locus_tag="ECD_00753"
FT                   /product="putative acetate transporter; BAX Inhibitor-1
FT                   family inner membrane protein"
FT                   /note="similar to b0786"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00753"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42654"
FT                   /protein_id="ACT42654.1"
FT                   /translation="MDRFPRSDSIVQPRAGLQTYMAQVYGWMTVGLLLTAFVAWYAANS
FT                   AAVMELLFTNRVFLIGLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIF
FT                   IVYTAASIASTFVVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKS
FT                   EALMWAVTYIGVIVFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINL
FT                   FLMLLRIFGNRR"
     atggacagat tcccacgttc tgattcaatc gtacaacccc gggctggctt gcaaacttat        60
     atggcgcaag tctatggctg gatgaccgtt ggcttgttgc tgaccgcatt tgttgcctgg       120
     tatgcggcta attccgcggc cgtgatggag ctgttgttca ctaaccgtgt ctttttaatc       180
     ggtctgatca tcgcgcaatt agcattggtt attgtgttat cagcgatgat tcaaaagctg       240
     agcgcaggtg taacgacgat gctctttatg ctttattcgg cgctgacggg tcttacgctt       300
     tccagtatat tcattgtcta taccgctgct tctatcgcca gtactttcgt cgttactgcc       360
     gggatgttcg gcgcaatgag cctgtacggt tacaccacga agcgcgattt aagtggcttt       420
     ggcaatatgc tgtttatggc gttaatcggc attgtgctgg catcgctggt caacttctgg       480
     ctgaaaagcg aagcgttgat gtgggcagtc acctacatcg gcgtgattgt ctttgtcgga       540
     ttgacggcgt atgacaccca gaaactgaaa aatatgggtg agcagataga tacccgcgac       600
     acgtcgaacc tgcgcaaata ttccattctt ggcgcgttaa ccttgtatct ggacttcatc       660
     aacctgttcc tgatgttgct gcggatcttc ggcaaccgcc gttaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page