(data stored in ACNUC7421 zone)

EMBL: CP001509.YKFJ

CP001509.YKFJ        Location/Qualifiers
FT   CDS_pept        257961..258227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfJ"
FT                   /locus_tag="ECD_00230"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0235"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42129"
FT                   /protein_id="ACT42129.1"
FT                   /translation="MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQR
FT                   VVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRCNGAGNRNGPLL"
     atggaatggt acatgggcaa atatattcgt cccttatccg atgcggtatt taccatcgca        60
     tctgatgacc tgtggatcga gagtttagcg atccaacaat tacacaccac ggcaaattta       120
     cccaacatgc agcgcgtagt ggggatgcca gatttacacc ccggacgcgg ctacccgatt       180
     ggcgcagcgt tcttctctgt tggtcgtttt tacccgacaa gacgtcgctg taacggtgct       240
     ggaaacagaa acgggccgct actctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page