(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGG

CP001509.YKGG        Location/Qualifiers
FT   CDS_pept        293386..294081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECD_00264"
FT                   /product="LutC family protein; putative electron transport
FT                   chain YkgEFG component"
FT                   /note="similar to b0308"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42163"
FT                   /protein_id="ACT42163.1"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAENISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPEYS
FT                   LFILRKSTILPRVAQLAEKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
     atggataatc gaggcgaatt tttgaataac gttgctcagg cactgggtcg cccgctgcga        60
     cttgaaccgc aagcagaaga tgcgccgctt aacaactatg ctaacgagcg gcttacccaa       120
     cttaaccaac agcagcgctg tgacgcgttt attcagtttg ccagcgatgt tatgttgacg       180
     cgctgtgagc tgaccagcga ggcgaaggcg gcagaagctg caatacgtct gtgtaaagag       240
     ctgggagatc agtcggtcgt gattagcggt gacacgaggc tggaggaatt ggggattagc       300
     gaacgtttgc agcaggaatg caatgccgtt gtttgggatc cggcgaaagg tgccgagaat       360
     atctcgcagg cagagcaggc taaagtgggt gttgtgtatg ctgaatatgg tttaaccgaa       420
     tcgggaggcg tggttctttt ttccgccgcc gagcgcgggc gttcattgag cctgctcccg       480
     gaatattctc tttttatcct gcgtaaaagc actatcctgc cgcgtgtagc gcaactcgca       540
     gaaaaattgc atcagaaagc gcaggccggt gaacgaatgc cttcctgcat taacatcatt       600
     agcggcccca gttcaacggc ggatattgag cttatcaaag tcgtcggagt tcatggcccg       660
     gtgaaagcgg tgtatctgat tattgaggat tgttga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page