(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGH

CP001509.YKGH        Location/Qualifiers
FT   CDS_pept        complement(294324..294992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgH"
FT                   /locus_tag="ECD_00266"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to b0310"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42165"
FT                   /protein_id="ACT42165.1"
FT                   /translation="MREQIKQDIDLIEILFYLKKKIRVILFIMAICMAMVLLFLYINKD
FT                   NIKVIYSLKINQTTPGILVSCDSNNNFACQTTMTEDVIQRITTFFHTSPDVKNREIRLE
FT                   WSGDKRALPTAEEEISRVQASIIKWYASEYHNGRQVLDEIQTPSAINSELYTKMIYLTR
FT                   NWSLYPNGDGCVTISSPEIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSGQ
FT                   "
     atgcgtgaac aaatcaaaca ggatatcgat ctgattgaga ttttatttta tctgaagaaa        60
     aagattcgtg ttatcctttt tattatggct atatgtatgg ctatggtgct gttgtttctg       120
     tatatcaata aagacaatat aaaagtgatt tacagcctaa aaataaacca gacaacgcca       180
     ggtatacttg ttagctgtga tagcaataat aattttgcct gtcagactac aatgactgaa       240
     gatgttattc agcgaattac tacatttttt cacaccagcc cagatgtcaa gaacagagaa       300
     ataaggctgg aatggtcagg agataagaga gctttaccaa ctgctgaaga ggaaatatct       360
     cgcgtgcagg cctctattat caaatggtat gcgtcagaat atcataatgg caggcaagtt       420
     ctcgatgaga tacaaacgcc ttcagcaatt aacagtgagc tttatacaaa aatgatatac       480
     ctgaccagga actggtcatt gtatccgaac ggtgatggct gtgtaactat aagctcacca       540
     gaaataaaaa ataaataccc tgctgccatt tgcctggctc tgggattttt tctaagcatt       600
     gtaatttctg taatgttttg ccttgtcaaa aaaatggtag atgaatacca acaaaactct       660
     gggcagtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page