(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGJ

CP001509.YKGJ        Location/Qualifiers
FT   CDS_pept        complement(274038..274367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgJ"
FT                   /locus_tag="ECD_00247"
FT                   /product="UPF0153 cysteine cluster protein"
FT                   /note="similar to b0288"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42146"
FT                   /protein_id="ACT42146.1"
FT                   /translation="MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFH
FT                   RCMSGTNQKNPRCIALAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKY
FT                   GLTPL"
     atgagcaatc tgaatccatg catgacgtgt ggtgcctgtt gtgcattttt ccgcgtctct        60
     ttttactggg ccgaagccga cgatgctggc ggtactattc ccgccaggct cactgaacaa       120
     atatcccctt ttcaccgatg catgagcggt accaatcaga aaaacccccg atgtattgcc       180
     cttgcaggaa ccccgggcaa aaatgcctgc tgcacgatat ataaaaatcg atcgtccaca       240
     tgcagagaat ttgccatgtc tggtgagaac ggagtcgtca atgaggcttg caatcgtgca       300
     agggctaaat acgggctgac accgttataa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page