(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGM

CP001509.YKGM        Location/Qualifiers
FT   CDS_pept        complement(282697..282960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECD_00255"
FT                   /product="50S ribosomal protein L31 type B; alternative
FT                   zinc-limitation L31 protein"
FT                   /note="similar to b0296"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42154"
FT                   /protein_id="ACT42154.1"
FT                   /translation="MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
     atgaagccca atatccatcc tgagtatcgt actgtggtgt tccacgacac cagtgttgat        60
     gagtacttta aaatcggctc gactatcaaa acagaccgtg agattgagct ggatggcgta       120
     acgtatccat acgtgacaat tgatgtctct tctaaatcgc acccgttcta tacagggaag       180
     ctgagaacag tggcatcaga aggaaatgtt gcacgattca cccaacgttt tggtcgtttt       240
     gttagcacga aaaagggggc gtga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page