(data stored in ACNUC7421 zone)

EMBL: CP001509.YKIA

CP001509.YKIA        Location/Qualifiers
FT   CDS_pept        373294..373575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="ECD_00339"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0392"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42238"
FT                   /protein_id="ACT42238.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPALLLTTLTEPQDRSLAINNPQLAAD
FT                   VKTAWLKEDPSLLLFVEQPDLSLLRDLVKTGATRKIRSEARHRLEEKQ"
     ttgctgcaaa gtcgcaatga tcatttacgc caaacggcat tgcgcaacgc acataccccg        60
     gcgttgttgt taacgacatt gactgagcct caggatcggt cgctggctat taataatcca       120
     cagctggctg ccgatgtgaa aacggcgtgg ttaaaagagg atccatcatt actcttattt       180
     gtcgaacaac ccgatctttc gctgttacgt gatttagtga aaaccggggc aacgcggaaa       240
     attcgcagtg aagcgcgtca ccggcttgag gaaaaacaat ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page