(data stored in ACNUC7421 zone)

EMBL: CP001509.YLAC

CP001509.YLAC        Location/Qualifiers
FT   CDS_pept        complement(447827..448297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECD_00409"
FT                   /product="DUF1449 family inner membrane protein"
FT                   /note="similar to b0458"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42308"
FT                   /protein_id="ACT42308.1"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
     atgaccgaaa tacaacgcct gctgaccgaa acgattgagt ctctgaatac ccgcgaaaaa        60
     cgcgacaaca aaccccgctt tagtatcagt tttatccgta aacatccggg gctgtttatc       120
     ggtatgtacg ttgctttttt tgccaccctg gcggtgatgt tgcagtccga aacgctgtca       180
     ggctctgtct ggctactggt tgtattattt atcctgctta atggtttctt ctttttcgat       240
     gtctacccac gctaccgcta tgaagatatc gacgtgctgg atttccgcgt ttgctataac       300
     ggcgaatggt acaacacgcg ctttgtacct gccgcgctgg ttgaagccat cttgaactct       360
     ccgcgtgtcg cggatgttca taaggaacaa ctgcaaaaaa tgatcgtccg taaaggtgaa       420
     ctgtcttttt acgatatttt taccctcgct cgcgccgaat caacatctta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page