(data stored in ACNUC7421 zone)

EMBL: CP001509.YLBF

CP001509.YLBF        Location/Qualifiers
FT   CDS_pept        518772..519587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECD_00470"
FT                   /product="putative anaerobic allantoin catabolic oxamate
FT                   carbamoyltransferase; DUF2877 family protein"
FT                   /note="similar to b0520"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42369"
FT                   /protein_id="ACT42369.2"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLTAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     atgacgatca tccatcctct gcttgccagc cgtagtgcac cgaattatcg ccagtcctgg        60
     cggttagcgg gagtgtggcg acgggcgatt aacctgatga cggaaagcgg cgaactgtta       120
     acgctgcatc gtcagggtag tggtttcggc cccggaggat gggtgcttcg ccgcgcgcaa       180
     ttcgatgcgt tatgcggtgg attatgcggc aatgaacgac cacaggttgt ggctcaaggg       240
     attcgcctcg ggcgtttcac ggttaaacag ccacagcgtt attgtttgct gcgtattacg       300
     ccgcctgcgc atcctcaacc gcttgcagct gcatggatgc aacgcgcgga ggaaaccggg       360
     cttttcgggc cactggcgtt ggcggcaagc gatccgctga ccgctgaatt acgccagttt       420
     cgtcactgtt ttcaggccgc gctcaatggc gttaagaccg actggcggca ctggctgggt       480
     aaaggacccg gattaacgcc aagtcatgat gacacgttga gcggaatgct gctggcggcc       540
     tggtattatg gcgctttaga tgcgcgctct ggtcgcccgt tttttgcctg ttccgacaat       600
     cttcaactcg ttaccacagc ggtgagcgtc agttatttac gttatgccgc gcaaggatat       660
     ttcgcctcgc cactcctgca ctttgttcat gctctgagtt gcccgaaacg taccgctgtt       720
     gcgattgatt cgctgctggc gctggggcat acgtcagggg cagatacgct gctggggttc       780
     tggcttggcc aacaattatt acaaggaaaa ccatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page