(data stored in ACNUC7421 zone)

EMBL: CP001509.YLCG

CP001509.YLCG        Location/Qualifiers
FT   CDS_pept        542325..542465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcG"
FT                   /locus_tag="ECD_00501"
FT                   /product="uncharacterized protein, DLP12 prophage"
FT                   /note="similar to b4509"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42399"
FT                   /protein_id="ACT42399.1"
FT                   /translation="MMFEFYMAELLRHRWMRLRLYRFPGSVLTDYRILKNYAKTLTGAG
FT                   V"
     atgatgtttg agttttatat ggcagaactt cttcgccacc gctggatgcg cctgcgctta        60
     tatcgtttcc ccggttctgt tttgaccgat taccgaatac tgaagaatta cgccaaaaca       120
     ctgacaggag caggagtatg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page