(data stored in ACNUC7421 zone)

EMBL: CP001509.YOEA

CP001509.YOEA        Location/Qualifiers
FT   CDS_pept        517502..518761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoeA"
FT                   /locus_tag="ECD_00469"
FT                   /product="hypothetical protein"
FT                   /note="similar to b4507-b0519(b4582); pseudo in K-12 MG1655
FT                   (interrupted by frameshift)"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42368"
FT                   /protein_id="ACT42368.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAMLEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEM
FT                   AEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
     atgtttacat cagtggcgca agccaatgct gcggttatcg aacaaattcg tcgcgctcgt        60
     ccacactggc tggatgtgca accggcttct tcacttatca gcgaactaaa cgagggcaaa       120
     acactgcttc acgccgggcc gccaatgcgc tggcaggaga tgaccggacc catgaaaggg       180
     gcgtgcgtgg gcgcatgtct gttcgaaggc tgggcgaaag atgaagcgca ggcactggcg       240
     atgctggagc agggggaagt gaacttcatt ccttgtcacc atgtgaatgc cgtcgggcca       300
     atgggcggca ttacttctgc cagtatgccg atgctggtgg tcgagaacgt gaccgacggc       360
     aaccgggcgt actgcaacct caacgaaggt atcggcaaag tgatgcgttt tggcgcttac       420
     ggcgaagatg tcctgactcg ccatcgctgg atgcgcgatg tgttaatgcc agtattaagc       480
     gcggcgctgg ggcgcatgga gcgcggtatc gatctcacgg cgatgatggc gcagggcatt       540
     acgatgggcg atgagttcca tcaacgcaat attgcttcct ctgcactgtt aatgcgtgcg       600
     ctggccccac aaattgctcg cctcgatcat gataaacagc acatcgccga agtgatggat       660
     ttcctcagcg tgaccgatca gttcttcctc aacctcgcga tggcttactg caaggcggcg       720
     atggatgctg gcgcgatgat ccgcgcaggc agcatcgtca cggcaatgac ccgcaacggc       780
     aatatgttcg ggattcgggt aagcgggctg ggcgaacgct ggtttactgc gcctgtaaac       840
     actccgcaag gtctgttttt caccggcttc tcgcaggagc aggcgaaccc ggatatgggc       900
     gatagcgcga ttaccgaaac ctttggtatc ggaggtgcgg caatgatcgc agcgcctggc       960
     gtaacgcgct ttgtcggtgc gggtggcatg gaagcggcca gagcggtatc tgaagagatg      1020
     gcggaaattt accttgagcg caatatgcag ttgcagatcc caggctggga ttttcagggc      1080
     gcgtgcctgg gactggacat tcgtcgcgtg gtagaaaccg gcattacgcc actcatcaat      1140
     accggtatcg cccataaaga ggcggggatc gggcagattg gcgcaggcac tgtgcgggca      1200
     ccgctggcgt gttttgaaca ggcgctggaa gcactggctg aaagcatggg gattggttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page