(data stored in ACNUC30630 zone)

EMBL: CP001515.ADK

CP001515.ADK         Location/Qualifiers
FT   CDS_pept        480229..480801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="Balac_0403"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG0563 Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45786"
FT                   /protein_id="ACS45786.1"
FT                   /translation="MRLLIMGPQGVGKGTQAKLLAEHYGIPTISTGDIFRANIKNKTEL
FT                   GKKVLEYTSQGFLVPDELTNEIVRDRLAQDDAKNGWILDGYPRNVAQVSALDEILEGLG
FT                   EQLDAVVALTAPTNVLLERMAKRAKEEGRADDTPEAIQNRLNTYDKETTPVLDIYQQRG
FT                   KLVTVNGVGEIDAISEEIVKALDAKLG"
     atgcgactgc tgattatggg acctcagggc gtcggcaagg gcacacaggc gaagctgctc        60
     gccgagcact acggcattcc gacgatctcc accggagaca tcttccgcgc gaacatcaag       120
     aacaagacgg aactgggcaa gaaggtgctt gaatacacgt cgcagggatt cctggtcccc       180
     gacgagctca ccaacgagat cgtccgcgat cgtcttgcgc aggatgatgc gaagaatggc       240
     tggatcctcg atggctaccc acgcaatgtc gcccaggtga gcgcgctcga cgagattctc       300
     gagggcctcg gcgagcagct cgacgccgtt gtcgcgctga ccgcccccac caatgtgctg       360
     cttgagcgca tggccaagcg cgcgaaggag gaggggcgtg ccgacgacac cccggaggcg       420
     atccagaacc gtctgaacac ctacgacaag gagaccacgc cggtgctcga catctaccag       480
     cagcgcggca agctcgtcac cgtgaacggc gtgggcgaga tcgatgcgat cagcgaggag       540
     atcgtcaagg cactcgatgc caagcttggc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page