(data stored in ACNUC30630 zone)

EMBL: CP001515.ILVH

CP001515.ILVH        Location/Qualifiers
FT   CDS_pept        complement(342689..343243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="Balac_0275"
FT                   /product="acetolactate synthase 3 regulatory subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0440 Acetolactate synthase, small (regulatory
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45666"
FT                   /protein_id="ACS45666.1"
FT                   /translation="MASYPASKPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRITVTADVEEVPLEQIIKQLNKLLHVLKIVDLDESTTVERELVLIKVAA
FT                   DQSNRSDVLEIVRLFRVRVVDVNPESLTIEATGAGGKIDALLGLLDHYGIIELVRSGAV
FT                   AMTRGPRALSEKVVGSEITGR"
     atggcttcat atccagcatc caagccgggt tcccagcgtc atacgctgtc ggtgctcgtc        60
     gagaaccgcc cgggtgtgct cgcacgcatc gccggcctgt tcgcccgccg tgcgttcaac       120
     atcaactcgc tgagcgtctc acccaccgag cgccccgaca tctcccgcat cacggtgacc       180
     gccgacgtcg aggaggtgcc gctcgagcag atcatcaagc agctcaacaa actgctgcat       240
     gtgttgaaaa tcgtcgacct cgacgaatcg accaccgtcg agcgcgaact cgtgctcatc       300
     aaggtcgccg cggaccaatc gaaccgctcc gatgtgcttg agatcgtcag actgttccgc       360
     gtgcgcgtcg tcgatgtcaa tcccgagtcg ctcacgatcg aggcgaccgg cgccggcggc       420
     aagatcgacg cgctgctcgg tctgctcgac cactacggca tcatcgagct cgtgcgttcc       480
     ggcgcggtcg cgatgacccg cggcccgcgc gcgctgagcg agaaagtggt cggcagcgag       540
     atcaccggcc gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page