(data stored in ACNUC30630 zone)

EMBL: CP001515.PE106

CP001515.PE106       Location/Qualifiers
FT   CDS_pept        complement(127054..127317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45504"
FT                   /protein_id="ACS45504.1"
FT                   /translation="MGILFINGGEIGGNTAHLGHAFLEGRDFTQIDLAGKRLFFLFRGG
FT                   APTQQMYERGEYTINRFAGLYGMDYMGMARNASEARALAAKL"
     atgggcattc tgttcatcaa tggcggcgag atcggcggta acaccgcgca ccttggccac        60
     gcgttcctcg agggccgcga tttcacgcag atcgacctcg ccggcaaacg cctcttcttc       120
     ctgttccggg gcggcgcgcc cacgcagcag atgtacgagc gcggcgaata caccatcaac       180
     cgcttcgccg gcctgtacgg tatggattac atgggcatgg cccgcaatgc aagcgaggcg       240
     cgcgcactcg ccgccaagct gtga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page