(data stored in ACNUC30630 zone)

EMBL: CP001515.PE112

CP001515.PE112       Location/Qualifiers
FT   CDS_pept        complement(131417..132403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0116"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45510"
FT                   /protein_id="ACS45510.1"
FT                   /translation="MTALELTPVWDKTFPQSDKVEHGKITFHNRYGIELAADVYKPKRV
FT                   PANGRFKAIAVSGPFGAVKEQASGLYAQTLAERGFLTIAFDPSFTGESGGSPRAVASPD
FT                   INTEDFSAAVDYLANRTDVDPEGIGIVGICGFGGLALNAAANDPRIKATVASTMYDMSR
FT                   VTANGYFDADDSAAKRNEMRTQLAKQRTEDYANGDYARAGGVIDPLPDDAPQFVRDYHA
FT                   YYKTPRGYHARSVNSNAGWNVTSSLPFMNMPLMTYIGEIENPALLIHGEKAHSLYFSKA
FT                   AYEKLEHGVNPANKELLIIPGANHTDLYDNLNAIPFDTIAGFFTRNL"
     atgacggcac ttgaactgac cccggtatgg gacaagacct tccctcagag cgacaaggtg        60
     gagcacggca agatcacctt ccacaaccgt tacggcatcg agctggcggc cgacgtatac       120
     aagccgaagc gcgtgccggc gaacggcaga ttcaaggcga tcgccgtctc gggacccttc       180
     ggcgcagtga aggagcaggc aagcggcctg tatgcgcaga ccttggccga gcgcgggttc       240
     ctcacgatcg cgttcgaccc gtcgttcacc ggcgaatccg gcggctcgcc ccgcgcggtc       300
     gcctcccccg acatcaacac cgaggatttc tccgccgccg tggactatct ggcgaaccgc       360
     accgacgtgg atccggaggg catcggcatt gtgggtatct gcggcttcgg cggcctggca       420
     ctcaacgcgg ccgcgaacga cccgcgcatc aaggccaccg tggcgagcac catgtacgac       480
     atgagccgcg tcaccgcgaa cggctacttc gacgccgacg actcggccgc caaacgcaat       540
     gagatgcgca cacagctggc caagcagcgc accgaggact acgcgaacgg cgactatgcg       600
     cgcgccggcg gcgtcatcga cccgctgccc gacgacgccc cgcagttcgt cagggactac       660
     cacgcgtact acaagacccc gcgcggctac catgcgcgct cggtgaactc gaatgccggc       720
     tggaacgtca cctcgtcgct gccgttcatg aatatgccgc tgatgaccta catcggcgaa       780
     atcgagaacc cggcgctgct catccacggc gagaaggcgc attcgctgta cttcagcaag       840
     gccgcgtatg agaagctcga gcatggcgtg aatccggcga acaaggaact gctgatcatc       900
     ccgggggcca atcacaccga cctgtatgac aatctcaatg cgatcccgtt cgacacgatc       960
     gccgggttct tcacgcggaa tctgtaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page