(data stored in ACNUC30630 zone)

EMBL: CP001515.PE12

CP001515.PE12        Location/Qualifiers
FT   CDS_pept        16847..16990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45410"
FT                   /protein_id="ACS45410.1"
FT                   /translation="MCGARKANGSDHKLVIQMNANGVTFEAYPSLKGKDAQVRQAGRVE
FT                   RG"
     gtgtgcggcg cgcgcaaggc gaacggctcc gatcacaagc ttgtgatcca gatgaacgcc        60
     aacggagtca ccttcgaggc ctatccgtcg ctcaagggca aggatgcgca ggtgagacaa       120
     gccgggcgtg tggaacgtgg ctag                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page