(data stored in ACNUC30630 zone)

EMBL: CP001515.PE128

CP001515.PE128       Location/Qualifiers
FT   CDS_pept        147437..148873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0132"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system permease component"
FT                   /note="COG0559 Branched-chain amino acid ABC-typetransport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45526"
FT                   /protein_id="ACS45526.1"
FT                   /translation="MASMVSQPQRRAERGRRRKGLAIVCAGIAGLLLAMLASMIGVPNA
FT                   VAAEAVDKCVPNAEHGCVSGILQTQDKTPIPDVTVTLGGEEEATATTAEDGAWAFEVNA
FT                   DGEYTVSIDKAVAEKYKLGESGATVEIAKKSFSKQRAVVRFDKAAAGSAAETESGNADS
FT                   AKSGEQTAANTAQAGDDGKGSGFWSRFWQQLYSGCIFGLMLGLMAVGMNLVYGTTGLSS
FT                   FSHGEQVTLGGLMAYVGTQMLHMPVVLSAIFAVAIGALAGWVQNQLVWAPLRHKRVGVM
FT                   QQMIVTIGLSMALQYIYQFFFGGDIKGIVKSVPEGIQLGPIVTNAPTLIAAAIALVTIV
FT                   SVTVFLYCTRLGRATRAVSDNAALAAASGINVDSVVRIVWILSCGLAALSGVLIGIHLN
FT                   GIAWNTGVTLLMLMFAAVTLGGLGTANGALVGALIVGIVADMSTLVIPSDMRYASALAI
FT                   LILVLLIRPQGIFGKQKRVG"
     atggcatcca tggtttcaca accacaacgc cgtgccgaac gcgggcggcg ccgaaagggt        60
     ctggccatcg tgtgtgcggg catcgcgggc ttgttgctgg cgatgctcgc cagcatgatc       120
     ggcgtgccga acgccgtggc cgcggaggcg gtggacaagt gcgtgccgaa cgcggagcac       180
     ggctgtgtga gcggcattct gcagacccaa gacaagacgc cgatccccga cgtgacggtc       240
     acgttgggcg gcgaggagga ggccacggcc accactgcgg aggacggtgc ctgggccttc       300
     gaagtgaatg cggacggcga gtacaccgtg agcatcgaca aggcggtcgc cgagaagtac       360
     aagctcggcg aaagcggcgc gacggtggag atcgccaaga agtcgttctc caagcagcgt       420
     gccgtcgtgc gcttcgacaa agccgcggca ggcagtgcgg cggaaacgga aagcggcaat       480
     gccgactccg ccaaaagcgg ggagcagact gcggcgaata ccgcgcaggc cggcgatgac       540
     ggcaagggct ccggcttctg gtcgcgcttc tggcagcagc tctactcggg ttgcatcttc       600
     ggcctcatgc tcggcctgat ggcggtgggc atgaacctcg tgtacggcac caccggcctg       660
     agctccttct cccatggcga gcaggtgacg ctcggcggtc tcatggccta tgtgggcacg       720
     cagatgctgc atatgccggt cgtgctctcg gccatcttcg cggtggcgat cggcgcgctc       780
     gccggatggg tgcagaacca gctcgtctgg gcaccgctgc ggcacaagcg cgtgggcgtc       840
     atgcagcaga tgatcgtgac gatcggcctg tcgatggcgt tgcagtacat ctaccagttc       900
     ttcttcggcg gtgacatcaa gggcattgtc aagtcggtgc cggagggcat tcagctcggc       960
     ccgatcgtca cgaacgcccc gacgctcatc gcggcggcca ttgcactggt gaccatagtc      1020
     tccgtcaccg tgttcctcta ctgcacgaga ctgggccgcg ccacccgagc cgtgtccgac      1080
     aacgcggcgc ttgcggcggc ctcgggcatc aacgtggatt cggtggtgcg catcgtgtgg      1140
     atcctctcct gcggcctggc cgcgctctcc ggcgtgctca ttggcatcca cctcaacggc      1200
     atcgcctgga acaccggcgt cacgttgctt atgctcatgt tcgccgccgt cacgctcggt      1260
     ggcctcggca ccgcgaacgg cgctctggtg ggcgccctga tcgtgggcat tgtggccgat      1320
     atgagcacgc tcgtcattcc cagcgacatg cgctacgcca gcgcgctggc aattctgatt      1380
     ctcgttctgc tgattcgccc gcagggcatt ttcggcaagc aaaagagggt gggctga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page