(data stored in ACNUC30630 zone)

EMBL: CP001515.PE130

CP001515.PE130       Location/Qualifiers
FT   CDS_pept        149853..150860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0134"
FT                   /product="branched-chain amino acid transport
FT                   systemATP-binding protein"
FT                   /note="COG0411 ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45528"
FT                   /protein_id="ACS45528.1"
FT                   /translation="MADTTDKTSETTAAGSTATVKEPFYDIAKWATKAPEGEKLISTAY
FT                   GDKVTEDLRYVKNEPGVHKPDPILVADNVTRRFGGMTAVDVRHFEIERHGITALIGPNG
FT                   AGKTTFFNLMTGFDTPNTGTWQFDGKDMAHVNPEKVARGGMVRTFQLTKVMSRLTVLDN
FT                   MMLGAQSHPGEGMFRSLFPGAWKKQEKENREKAEALLDRFLLYKKKDDYAGALSGGQRK
FT                   LLEMARALMCDPKLVMLDEPMAGVNPALKQSLLDHIISLREDGTTVLFVEHDINMVRHI
FT                   ADWVTVMAEGKIVAEGQPKTVMDDPAVVDAYLGAHANIDLGDDSVLEGLEGGNA"
     atggctgaca caaccgacaa gacaagcgag accacggccg ccggctcgac ggccaccgtg        60
     aaggaaccgt tctacgacat cgcgaaatgg gctacgaagg cgccggaggg ggagaagctc       120
     atctccaccg cctacggcga caaggtgacc gaagacctgc gctacgtgaa gaacgagccc       180
     ggcgtgcaca agcccgaccc gattctggtg gctgacaacg tcacccgtcg cttcggtggc       240
     atgacggccg tggatgtgcg gcatttcgag atcgaacgtc atggcatcac ggccctcatc       300
     ggcccgaacg gcgccggcaa gacgacgttc ttcaacctca tgaccggctt cgacaccccg       360
     aacaccggca cctggcagtt cgacggcaag gacatggccc atgtgaaccc ggagaaagtg       420
     gcccgcggcg gcatggtgcg caccttccag ctcaccaagg tgatgagccg gctcaccgta       480
     ctcgacaaca tgatgctggg cgcgcagagc caccccggcg agggcatgtt ccggtcgctg       540
     ttcccggggg cgtggaagaa gcaggagaag gagaaccgcg agaaggccga ggccctgctc       600
     gaccgcttcc tgctctacaa gaagaaggac gactacgccg gggcgctctc cggcggccag       660
     cgcaagctcc tcgaaatggc ccgtgcgctc atgtgcgacc cgaagctcgt catgctcgac       720
     gagccgatgg ccggcgtgaa cccggcgttg aagcagagcc tgctcgatca catcatctcg       780
     ctgcgcgaag acggcaccac ggtgctgttc gtggaacacg acatcaacat ggtgcgccat       840
     atcgccgact gggtcaccgt gatggccgaa ggcaagatcg tggccgaagg ccagcccaag       900
     acggtgatgg acgacccggc cgtggtcgac gcctacttgg gcgcccacgc caacatcgac       960
     ctcggcgacg actccgtact cgaaggattg gagggtggca atgcctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page