(data stored in ACNUC30630 zone)

EMBL: CP001515.PE137

CP001515.PE137       Location/Qualifiers
FT   CDS_pept        158700..159998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0141"
FT                   /product="biotin carboxylase/biotin carboxyl carrier
FT                   protein"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45535"
FT                   /protein_id="ACS45535.1"
FT                   /translation="MRLADEAYALGAAETADTYLNIDAMASAAVRAHADAVHPGHGFLA
FT                   ENADFAQAVIDAGMVWVGPKPETIRVLGSKVAARRIAAEVVEFAREHGLPIAIKAVYGG
FT                   GGRGLKVVHEPDEVAAAFESAMHEAEVAFGNGDCFVERFLARLWHVEVQVLGDQFGTVL
FT                   AVGTRDCSLQRRNQKLIEEAPAPFLAAETVRELERAAVAICSRAHYESAGTVGFLVDDG
FT                   TMSFMEVNTHIQVEHPVTEAVTGVDLVAAQLAIAEGAPVEAVPGLESGVTPEPRGGHAM
FT                   EFRINAEDPSLGFVPFPGVVESLQVPTGPGIRFDSGVAAGDSISSRYDSMIAELIVKAS
FT                   TRAECLRRAERALAELHIHGVPTVVPFDKAVLESADFGAGADWRADDDVSNANFRVYTR
FT                   WIEEELLPNLPSETLEDWRRAGERAMGERRRAG"
     gtgcgtctgg ccgacgaagc gtacgcactg ggtgcggccg agaccgccga cacctacctg        60
     aacatcgacg cgatggcgag cgccgccgtg cgcgcacacg ccgacgccgt gcatccgggg       120
     cacggattcc tcgccgagaa cgccgacttc gctcaggccg tgatcgacgc gggaatggtg       180
     tgggtggggc cgaagccgga gacgatccgc gtgctcggct cgaaagtcgc ggcgcgccgg       240
     atcgccgccg aagtggtcga gttcgcacgc gaacacggct tgcccatcgc gatcaaggcg       300
     gtctacggcg gtgggggccg tggcctgaag gtggtgcacg agcccgacga ggtggcggcc       360
     gccttcgaat cggcaatgca tgaggccgag gtggcgttcg gcaacggcga ttgcttcgtc       420
     gagcgcttcc tcgcacggct atggcatgtg gaggtgcagg tgctcggcga ccagttcggc       480
     accgtgctcg ccgtgggcac gcgcgattgc tcgctgcagc ggcgcaacca gaagctcatc       540
     gaggaggcgc ccgcaccgtt cctggctgcc gagaccgtgc gggagctcga gcgcgccgcg       600
     gtggcgatct gctcacgcgc gcactacgaa agcgcgggaa cggtggggtt cctcgtcgac       660
     gacggcacga tgagcttcat ggaggtcaat acgcacatcc aggtggaaca ccccgtcacc       720
     gaggcggtca ccggcgtcga tctcgtggcc gcccaactcg ccattgccga gggcgcgccg       780
     gtggaggcgg tgcccgggct tgaatccggc gtcacaccag agccgcgggg ggggcatgcg       840
     atggaattcc gcatcaacgc cgaagacccc tcactcggct tcgtgccgtt ccccggcgtc       900
     gtcgaaagcc tgcaggtgcc caccggcccc ggcatccgct tcgattcggg cgtcgcggcc       960
     ggcgactcca tctcaagccg ttacgattcg atgatcgccg agctcatcgt caaggcctcc      1020
     acgcgcgccg aatgcctgcg cagagccgaa cgcgcgctcg ccgaactgca cattcacggc      1080
     gtgcccactg tggtgccctt cgacaaggcg gtgctcgaat cagcggattt cggcgcgggt      1140
     gcagactgga gggccgacga cgatgtgtcc aatgcgaatt tccgcgtgta cacgcgctgg      1200
     atcgaggagg aactgctgcc gaatctgccc tcggaaacgc ttgaggactg gcgtcgcgcc      1260
     ggcgagcggg cgatgggcga acgccggcgg gccgggtaa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page