(data stored in ACNUC30630 zone)

EMBL: CP001515.PE152

CP001515.PE152       Location/Qualifiers
FT   CDS_pept        177915..178076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45550"
FT                   /protein_id="ACS45550.1"
FT                   /translation="MYDEGPHIVLRRDGVCIVAKTPDGDMPQIEYWGRDFAFDTAGDAL
FT                   RQLDMRAI"
     atgtacgacg agggaccaca tatcgtgctg cgtcgcgacg gcgtgtgcat cgtcgcgaag        60
     acgccggacg gcgacatgcc gcagatcgaa tactggggtc gtgattttgc gttcgacacc       120
     gccggggatg cgctgcgcca gctcgacatg cgcgcaatct ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page