(data stored in ACNUC30630 zone)

EMBL: CP001515.PE160

CP001515.PE160       Location/Qualifiers
FT   CDS_pept        complement(189299..189544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0164"
FT                   /product="putative ABC transport system integral membrane
FT                   protein"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45558"
FT                   /protein_id="ACS45558.1"
FT                   /translation="MIAIESVILSVFGTVLGILVGLGAGVVVRQAYRDNGLSTMSIPWL
FT                   QLLGFLGAAILVGLIASISPASRALKKPVLEAVASD"
     atgatcgcca tagaatcggt gattctctcg gtgttcggca ccgtgctcgg catcctcgtg        60
     gggctcggcg ccggcgtggt ggttcgccag gcgtatcggg acaacggtct ttccaccatg       120
     agcatcccat ggctgcaact gctcggcttc ctcggcgcgg ccattctcgt ggggttgatc       180
     gccagcatct cgccggcaag ccgcgcactc aagaaaccgg tgctcgaagc ggtggccagc       240
     gactga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page