(data stored in ACNUC30630 zone)

EMBL: CP001515.PE171

CP001515.PE171       Location/Qualifiers
FT   CDS_pept        complement(202038..203297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0175"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683 ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45569"
FT                   /protein_id="ACS45569.1"
FT                   /translation="MNKPNRKTWRTTATAMAATAVLTLSGCGTGTADSSANAAEDTFVA
FT                   GGLFPLTGTAAYLGPSNVSTMKLAEQDIDEAGGVLGNKISTITADTSDAEHADQNATAV
FT                   QSVLSKNPSVVIGPPLSSVVKNTYKQVTTSKIPMISPGATSTAFSGLDDYFFRTIPPDT
FT                   VQGVVMGDLIAQDGIKNLAIAVFNDEYGISLRAEVLKTLKEGGVNVVYGETETFDPAEN
FT                   NFSSIATNIKATNPDAVLVIAADQTIPLVKELAAKGIDTHKLYMPDSNMVDHSKDFTSG
FT                   LLKGSKGTIPGAHPTSEFQNALKTIAPDTTIYTYNTETYDAMVLAALAAEKGGAADSET
FT                   VQKNLMAVSGTTKGEKCESYEDCVALMKSGKEIQYVGKTSIGVFNNAHDPSTASIGIYE
FT                   YDDSNVPVFLDSQEGAVPQN"
     atgaacaagc ccaatcgaaa gacatggcgc accacggcca ccgcaatggc ggcgacggca        60
     gtgctcacat tgtcgggatg cggcacggga acagccgaca gctcggcaaa tgcggcggaa       120
     gacaccttcg ttgcgggcgg tctgttcccg ctcaccggaa ccgcggcata tctgggcccc       180
     tcgaacgtct ctaccatgaa gctcgccgag caggacattg acgaagcggg cggagtgctc       240
     ggcaacaaga tcagcaccat cacggccgac acctcggacg cggagcatgc ggaccagaac       300
     gcaacagcag tgcagtcggt actttcgaag aacccgtcgg tcgtcattgg cccgccgttg       360
     agctcggtcg tcaagaacac ctataagcaa gtgacgacgt cgaaaatccc tatgatttcg       420
     ccaggcgcca catccacggc gttctccgga ctcgacgact acttcttccg cacgatcccg       480
     ccggacaccg tgcaaggagt cgtcatggga gatctcatcg cacaggacgg catcaaaaat       540
     cttgccatcg cggtgttcaa cgacgagtac ggaatctcat tgcgcgcaga agtgctcaaa       600
     accttgaaag aaggcggggt gaacgtcgtg tacggcgaga cggagacctt cgacccggcc       660
     gagaacaact tctcatccat cgccacgaac atcaaggcga cgaatccgga cgccgtgctg       720
     gtcatagcgg cggaccagac gatcccgctc gtcaaggaac tggcggccaa gggcatcgac       780
     acccataagc tctatatgcc cgacagcaat atggtcgacc actcgaagga tttcaccagc       840
     gggctgctca agggttcgaa ggggacgatt cccggcgcac accccacctc cgagttccag       900
     aacgcgctca agaccatcgc gcccgacacg acgatctaca cctataacac cgagacctac       960
     gacgccatgg tccttgccgc attggccgcg gagaaaggcg gcgcggccga cagcgagacg      1020
     gtgcagaaga acctcatggc cgtttcgggt accaccaaag gcgagaaatg cgaatcttac      1080
     gaagactgcg tggccctgat gaagagcggc aaggaaattc agtacgtggg caagacctca      1140
     atcggcgtct tcaacaacgc ccacgacccg agcaccgcat cgattggcat ctatgagtat      1200
     gacgacagca atgtgccggt cttcttggat tcacaggagg gcgcagtgcc gcagaattag      1260
//

If you have problems or comments...

PBIL Back to PBIL home page