(data stored in ACNUC30630 zone)

EMBL: CP001515.PE178

CP001515.PE178       Location/Qualifiers
FT   CDS_pept        complement(212776..214359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0182"
FT                   /product="hypothetical protein"
FT                   /note="COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45576"
FT                   /protein_id="ACS45576.1"
FT                   /translation="MTEQSTNQRSATHDEPRRRPITRTAIAFLAGLAVCGLAASTLSGC
FT                   GNNAGENRTSAAAARQTTDSCDTTINVVASVNQWGSLAQQLGGSCVNVTSIINSTAADP
FT                   HDHEATPADLTKLARADVVVLNGAGYDGWAQKAQLDEGRQRIVKASSLMGIADSQDDHD
FT                   HEEGEGHHHHHGTVNPHLWFSPAAVLKMSEAITSAYVTKSGEASETAATARRHSNTWNA
FT                   EYAEYTALVNRARAKNLQRRYVATESIIGHLLDYIGATDKTPDSYTNAMNNDAEPSASD
FT                   LKNALDTVGSSNVDMLIVNPQEMGGFAKKLDAAARESGKTIISVTEQLPENHKTLLGWL
FT                   TTITNQALADDPQHGWFLTQQVKDRTIADYAGQWRSVYPLLKNGKLRGVMEHKAATGDK
FT                   TADEYTAYYDAGYKTDTETITIEGDRMAFTTNGRKVTATYRYDGHRILDYAKGNRGVRY
FT                   LFTATGDVPQGAPKAVQFSDHGIAPGKAAHFHIFTGDSHDEVIKQMEHWPTYYPASMSD
FT                   DEIVKEMLAH"
     atgacagaac aatctacaaa ccaacgctcc gcaacgcatg acgaaccacg acgccggccg        60
     atcacccgta ccgcgatcgc attcctcgcc ggccttgcgg tgtgcggact cgccgccagc       120
     actctgtcgg gttgcggaaa caacgccgga gaaaacagga cctcggccgc agccgcacgg       180
     cagaccaccg acagctgcga caccacgatc aacgtcgtgg cgtcggtgaa ccagtggggt       240
     tcgctcgccc agcagctcgg cggctcctgc gtcaacgtga cctcgatcat caattccacg       300
     gccgcagacc cccatgacca cgaagcgaca ccggcggatc tcacgaagct cgcacgcgcc       360
     gacgtcgtgg tgctcaacgg cgccggctac gacggatggg cccagaaggc gcagctcgac       420
     gaaggtcgcc agcgcatcgt gaaggcatcg tcgctcatgg gcatcgccga cagtcaggat       480
     gaccacgacc acgaagaggg cgaggggcac catcaccatc acggcacggt gaacccgcat       540
     ctgtggttca gcccggcggc cgtgctcaag atgtcggagg cgatcacctc cgcctacgtc       600
     acgaagtccg gtgaagcgag cgagacggcc gccaccgcgc gacgccactc gaatacctgg       660
     aacgccgaat acgccgaata cacggcgctc gtcaaccgcg cacgggcaaa gaacctgcag       720
     cgccgctatg tggccaccga atcgatcatc ggccacctgc tcgactacat cggcgccacc       780
     gacaaaaccc cggactccta cacgaacgcg atgaacaacg acgccgagcc ctcggcctcc       840
     gacctcaaga acgcgcttga cacggtgggg agttcgaatg tggacatgct catcgtcaat       900
     ccgcaggaaa tgggtggatt cgccaagaag ctcgacgcgg ccgcacgcga aagcggcaag       960
     acgatcatca gcgtcaccga gcagctgccc gagaaccaca agacgctgct gggctggctc      1020
     acgacgatca ccaaccaagc gctggccgac gatccccagc acggctggtt cctcacacag      1080
     caggtgaagg accgcaccat agccgactac gccggccaat ggcgttccgt ctacccgctg      1140
     ctcaagaacg gcaagctgcg tggcgtgatg gagcacaagg cagccaccgg cgacaagacc      1200
     gcagacgaat acaccgccta ttacgacgcc ggttacaaaa ccgacaccga gaccatcacc      1260
     atagagggcg accgcatggc attcacgacc aacgggcgca aggtgacggc cacctaccgc      1320
     tacgacggcc atcgcatcct cgactatgcg aagggcaacc gcggtgtgcg ctacctgttc      1380
     accgccaccg gtgacgtgcc gcagggcgcg ccgaaggccg tgcagttctc cgaccacggc      1440
     atcgcacctg gcaaggccgc gcacttccac atcttcaccg gcgactccca cgacgaggtg      1500
     atcaagcaga tggagcactg gcccacctac tacccggcgt cgatgagcga cgacgagatc      1560
     gtcaaggaga tgctcgccca ctga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page