(data stored in ACNUC30630 zone)

EMBL: CP001515.PE181

CP001515.PE181       Location/Qualifiers
FT   CDS_pept        complement(216519..217229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45579"
FT                   /protein_id="ACS45579.1"
FT                   /translation="MAQHDNTNTEIIRPQGGSQTQAAADTAQIAHTQADAPTQPQGYAF
FT                   DFAQQQGEQIPPSQGYAPQNGEQPFTTAANTAQPNMGGNGVPNNPQGGQMPMNGGAPGN
FT                   RGTATLRGKPGGKTIGIIAAISLGCGLVAGIAGTAVTNAIYRSNEPSHSNMMMRGIGDR
FT                   GFGEGDGDGESMPDFGSGNGSRNRRSYRADGQMPGMQDSDGANGESNGDARNRSQSNDS
FT                   DSNADSGSSDSSKN"
     atggcacagc acgacaacac gaacaccgag atcatccggc cgcagggcgg ttcgcaaacc        60
     caagcggcgg ccgacactgc gcagatcgcg catacccaag cggatgcgcc gacccaacca       120
     cagggctacg ccttcgactt cgcgcagcag cagggcgagc agattccgcc aagccagggc       180
     tatgcgccgc agaacggcga gcagcccttc accacggcgg ccaacaccgc gcagccgaac       240
     atgggcggca acggcgtccc gaacaatccg cagggcggtc agatgcccat gaatggcggc       300
     gcaccgggca accgcggcac ggcgacgttg cgcggcaaac cgggcggcaa gaccatcggc       360
     atcatcgcgg cgatcagcct cgggtgcggc ctcgtcgccg gcattgcggg cacggcggtc       420
     acgaacgcga tctaccggtc gaacgaaccg tcgcattcga acatgatgat gcgcggcata       480
     ggcgaccgcg gcttcggtga aggcgacggg gacggcgagt ctatgccgga cttcggctcg       540
     ggcaacggct cgcggaaccg ccgttcctac cgtgcggacg gccagatgcc gggcatgcag       600
     gattcagacg gcgccaacgg cgagtcgaac ggcgatgcgc gcaaccgcag ccagtccaac       660
     gattccgact cgaacgccga ctccggcagc tcggattcca gcaagaactg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page