(data stored in ACNUC30630 zone)

EMBL: CP001515.PE192

CP001515.PE192       Location/Qualifiers
FT   CDS_pept        230188..230535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0197"
FT                   /product="hypothetical protein"
FT                   /note="COG3937 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45590"
FT                   /protein_id="ACS45590.1"
FT                   /translation="MTDETKNETENKTNSAMPDFGEGLRKVFLAGVGAIAATAEKGQEL
FT                   VNDLVKRGELTVEQGKKLNSELAHKAGEKSDSLKEKLADASNTVRNAAAGLSDQAEQTI
FT                   KKATEKKSDEQ"
     atgactgacg aaaccaagaa cgaaaccgag aacaagacca actccgccat gccggacttc        60
     ggcgaaggcc tgcgcaaggt gttccttgcg ggcgtgggcg ccattgcagc tactgccgag       120
     aagggtcagg agctcgtgaa cgacctcgtc aagcgcggtg agctcaccgt ggagcagggc       180
     aagaagctca actccgaact cgcccacaag gccggcgaga agtccgactc gctcaaagag       240
     aagctcgcag acgcctccaa caccgttcgc aatgcggccg caggtctgag cgaccaggcc       300
     gagcagacga ttaagaaggc caccgagaag aagtccgacg agcagtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page