(data stored in ACNUC30630 zone)

EMBL: CP001515.PE193

CP001515.PE193       Location/Qualifiers
FT   CDS_pept        230644..232794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0198"
FT                   /product="Unusual protein kinase"
FT                   /note="COG0661 Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45591"
FT                   /protein_id="ACS45591.1"
FT                   /translation="MSDKNSDKSKRETEAHELRRDVRREEAGQRRQQRKDACEARHLEH
FT                   EEKRETSELIDLSNRLENQEAHSDGPAFDNPTDDALRATVETAESEKILHLGDEVDEQG
FT                   ATIEHNLQREEAEQSGGEASETAAQPETPAPQSAQSERPADAHTHDIPASIARRQQPQV
FT                   EETIGLFGMHKRNFSSEYHLTRMSKAKRLKQIGKIALEYDALHGLTPVKMRLMFEALGP
FT                   TFVKVGQILSMRSEILPESFCAELSKLRADADPMPYAIVLGTLENEYQRPIDEIFEHID
FT                   TTPLGSASLAQVHRATLKTGEDVAVKVQRPGVRETMAQDVSIMRSLAKGATKIMHSSQV
FT                   VDFRGVVEELWETFDEETNFLNEARNLAEFKRFCSHYAYMDCPTPFTDLCTEHVLVMQY
FT                   IDGIPISHTRELIDDGYSLNEIGTKLVDNYAAQILDAGFFHADPHPGNIEIRGGKIILL
FT                   DLGMTGRLDARTRVALKQMLFAVAKQNSADLADALLRFAGTDVERADYPSLLGDLDGIV
FT                   EEFGTVDLADLDLAAFITSLTQMARRHGIEIPSSVTTVGRALVTLEGLLDEFIPNVNMI
FT                   EIISQHIESSKTPVEMVKSEVKRLGIESEQALHSGLKGIVDAQTALHMLTRGELKMNLE
FT                   LVGSEEPLSQMSDMVNRLTMALIVVGLFIGSSIVYFAGMKPIIFGIPVVGFLGYVAAFV
FT                   LSVWIVIDILIKRHAAKHKARK"
     atgagcgaca agaacagcga caagtccaag cgagaaaccg aggcgcatga gctcaggcgt        60
     gacgtgcgac gcgaggaggc cgggcagcgc aggcagcagc gcaaggacgc ctgcgaggca       120
     cgccatctcg aacacgagga gaagcgcgag acctccgagc tcattgacct gagcaaccgt       180
     ttggagaacc aggaggcaca cagcgacggc ccggctttcg acaatccgac cgacgacgca       240
     ttgcgggcga cggtggagac cgccgaatcc gagaagatcc tgcatcttgg cgatgaagtg       300
     gacgagcaag gcgccaccat cgaacacaat ctgcagcgcg aggaagccga gcagtccggc       360
     ggtgaggcga gcgaaaccgc ggcacagccg gaaacgccag cgccgcaatc tgcgcagtcc       420
     gaacgcccgg cggacgcgca cacccacgac atcccggcga gcatcgcgcg caggcagcag       480
     ccgcaggtcg aggagacgat cggtctgttc ggcatgcata agcgcaattt ctcgagcgaa       540
     taccacctga cgcgcatgag caaggcgaaa cgcctcaagc agatcggcaa gatcgcgctc       600
     gaatacgacg cgctgcacgg cctcacgccg gtcaagatgc gcctcatgtt cgaagcgctc       660
     gggcccacct tcgtgaaggt cggtcagatt ctgtcgatgc ggtcggagat tctgcccgag       720
     tcgttctgcg ccgagctttc caaactgcgc gcggacgccg acccgatgcc gtacgcgatt       780
     gtgctcggaa cactggagaa cgaataccag cggcccatcg acgagatctt cgagcacatc       840
     gacactacgc cgctcggttc cgcatcgctc gcgcaggtgc accgtgcgac actgaaaacc       900
     ggcgaggacg tggccgtgaa ggtgcagcgg ccgggcgtgc gcgaaacaat ggcgcaggac       960
     gtctcgatca tgcgctcgct cgccaagggc gccacgaaaa tcatgcacag ctcgcaggtg      1020
     gtcgacttcc gcggcgtggt ggaggagctg tgggagacct tcgacgagga gacgaacttc      1080
     ctcaacgagg cgcgtaatct ggccgaattc aaacggttct gctcgcacta tgcgtacatg      1140
     gactgcccga cgccgttcac tgacctgtgc accgagcacg tgctcgtcat gcaatacatc      1200
     gacggcatac cgatctcgca tacgcgcgag ctgatcgacg acggctactc gctcaacgag      1260
     atcggcacca agctcgtcga caactacgcc gcgcagattc tcgacgccgg cttcttccac      1320
     gccgaccccc accccggcaa catcgagatt cgcggcggca agattattct gctcgacctc      1380
     ggcatgaccg gcagactcga cgcgcgcacc cgcgtggcgc tcaaacagat gctgttcgcc      1440
     gtggccaagc agaactcagc ggatctcgcc gacgcgctgc tccgcttcgc cggcaccgat      1500
     gtggagcggg cggactaccc gtcgctgctc ggcgatctcg acggcattgt ggaggagttc      1560
     ggcaccgtgg acctcgccga cctcgatctg gcggcgttca tcacctcgct cacgcagatg      1620
     gcgcgccggc acggcataga gatccccagc tcggtgacca cggtggggcg cgcgctcgtg      1680
     acgttggagg gtctgctcga cgagttcatt ccgaacgtca acatgatcga gatcatctcc      1740
     cagcacatcg aatcgtcgaa aacgccggtg gagatggtga aatccgaggt gaagagactc      1800
     ggcatagaga gcgagcaggc gctgcacagc gggcttaagg gcatcgtgga cgcgcagacc      1860
     gccctgcaca tgctcacgcg cggcgaactc aagatgaatc tcgagctcgt gggctccgag      1920
     gagccgctca gccagatgag cgacatggtg aaccgtctca cgatggcgct cattgtggtc      1980
     ggcctgttca ttggctcctc gatcgtgtat ttcgccggca tgaagccgat catcttcggc      2040
     ataccggtgg tcgggttcct cgggtacgtg gcggcgttcg tgctgtcggt ctggatcgtg      2100
     atcgacattc taatcaaacg gcacgcggcg aaacacaagg cgcgcaagta g               2151
//

If you have problems or comments...

PBIL Back to PBIL home page