(data stored in ACNUC30630 zone)

EMBL: CP001515.PE202

CP001515.PE202       Location/Qualifiers
FT   CDS_pept        243193..243729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0207"
FT                   /product="Flp pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45600"
FT                   /protein_id="ACS45600.1"
FT                   /translation="MRELDGLARSQIALAGRGNALQRRLLEVCPGWEPSPTLLLQLLEA
FT                   AIAQGVAIPRALECIGACCGGACAQVLGHVSAALLRGVCWDEAWAVLEHDGSSPASSAL
FT                   GLACRTLRAAWEDGVSPLPQIHAAIEQMDGSERARIEQRASRLSVRLLLPMGLCLLPAF
FT                   LLIAVVPTIMSFMRM"
     ttgcgcgaac ttgacggact ggcgcgctcg cagattgcgc tggcggggcg cggcaatgcc        60
     ttgcagcggc gattgctcga ggtatgcccg ggctgggagc cgtctcctac gttgctgttg       120
     caactgcttg aggcggcgat tgctcagggc gtcgcgattc cccgggcatt ggaatgcatt       180
     ggcgcatgct gcggcggcgc atgcgcgcag gtgctggggc atgtctccgc cgcactgctg       240
     cgcggtgtgt gctgggatga ggcgtgggcc gtgttggaac atgatggttc ctccccggct       300
     tcctcggcat tgggattggc atgccgcaca ttgcgtgccg cctgggagga tggcgtctcg       360
     ccgctgccgc agattcatgc ggccattgag cagatggacg gcagcgaacg cgcgcggatc       420
     gagcaacggg cgtcgcgatt gtcggtgcgg ttgctgctgc ctatgggact gtgcctgctg       480
     ccggcgttcc tgctcatcgc ggtggtgccg acgatcatgt cgttcatgcg tatgtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page