(data stored in ACNUC30630 zone)

EMBL: CP001515.PE205

CP001515.PE205       Location/Qualifiers
FT   CDS_pept        244616..245056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45603"
FT                   /protein_id="ACS45603.1"
FT                   /translation="MSAAARRVPTRSAPCIPHGLRAQDAGNASPSAVGIVLVVAVLLCT
FT                   IAAGARIAMARAQARTAADMSALAAADAYWNEAAADPCGIGSAVARNNAGAVESCEVID
FT                   MDVAMEVSTATGVPFVERVSARARAGPRRCDEVDATRGASQP"
     atgagcgctg cggcgaggcg tgtgccgacg cgatccgcgc catgcattcc gcatggtctg        60
     cgggcgcagg atgccggcaa tgcgtcgccg agtgcggtcg gcatcgtgct cgtggtggcc       120
     gtgctgctgt gcaccatcgc ggccggggcc aggattgcca tggcccgggc gcaggcgcgc       180
     accgcagccg atatgtcggc attggccgcc gccgacgcct attggaacga ggctgccgcc       240
     gacccttgcg gcatcggctc tgccgtggcg cgcaacaatg cgggagccgt ggaatcatgc       300
     gaggtgatcg acatggatgt ggccatggag gtcagcaccg caacaggcgt gccgttcgtg       360
     gagcgggtga gcgcacgcgc gcgtgccgga ccacggcgat gcgatgaggt cgacgcaaca       420
     cgcggcgcat cgcaaccgtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page