(data stored in ACNUC30630 zone)

EMBL: CP001515.PE227

CP001515.PE227       Location/Qualifiers
FT   CDS_pept        complement(277025..277969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45625"
FT                   /protein_id="ACS45625.1"
FT                   /translation="MTFNDEHAVEQVASLPAMKTAVRSGTDLTELWPLTTAERMDNDAK
FT                   YAENLQVRLTLTMARVLVGTTEVTLPDAEFVYEGADAIPGRPQEVVDALLAANDAYEQL
FT                   NPYSDSHDFSLLFEAAETLTAGWSEATQKQLGEILDDCTAYIHDTDQKRVTGLDHRFAV
FT                   VLVTFAQMLRVLRSQIIANLGSDSPHTGGASSDRVRHLERVALPLLPFINEFAETLGVP
FT                   RICVTADQWHGLLAAFATPNGDDDSADSARVLAESLLPLAAAEWRKHREDILWDPAEAK
FT                   RAAKEEDERKNKEALAAKFAHIKDDPSKPEVEL"
     atgacgttca acgatgaaca cgccgtcgag caggtcgcat cgctgcccgc aatgaagacc        60
     gccgtgcgca gcggcaccga cctcaccgag ctgtggccgc tcaccaccgc cgagcgcatg       120
     gataacgacg caaagtacgc ggagaatctg caggtgcggc tcacgctcac aatggcgcgc       180
     gtgctcgtcg gcaccacgga ggtcacgctc cccgacgccg aattcgtata cgagggcgcg       240
     gatgcgattc cgggtcgccc ccaggaagtc gtcgacgcgc ttctcgctgc caatgacgcc       300
     tatgagcagc tcaatccgta ctcagattcg catgatttca gtcttctgtt cgaggccgcc       360
     gagacgctga ctgccggctg gagcgaggcg acgcaaaaac agctcggcga gatcctcgat       420
     gactgcactg catatattca tgacaccgat cagaagcgcg tcaccgggct cgaccaccgc       480
     ttcgccgtgg tgctggtcac gttcgcgcag atgctccgcg tgctgcgttc acagatcatc       540
     gccaatctcg gctccgattc gccacacacc ggcggcgcct cctccgaccg cgtgcgccat       600
     ctcgagcgcg tcgcgctccc gctgctcccg ttcatcaatg aattcgccga aacgctgggc       660
     gtgccgcgca tctgcgtgac cgccgaccaa tggcacggtc tgctcgccgc attcgccacg       720
     ccgaatggcg atgacgactc cgcagattcc gcccgcgtac tcgccgaatc cctactcccg       780
     cttgccgcgg cggagtggcg caagcaccgc gaagacattc tgtgggaccc ggccgaggcc       840
     aagcgcgccg ctaaggagga ggacgagcgc aagaacaagg aggccctcgc cgccaagttc       900
     gcgcatatca aagacgatcc gtccaagccc gaagtcgagc tctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page