(data stored in ACNUC30630 zone)

EMBL: CP001515.PE243

CP001515.PE243       Location/Qualifiers
FT   CDS_pept        300654..301769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0250"
FT                   /product="hypothetical protein"
FT                   /note="COG1266 Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45641"
FT                   /protein_id="ACS45641.1"
FT                   /translation="MTEPGRPQSPQQNTRAGEFQQAWQGEFQQPQYWQEPQQNPWQEPP
FT                   MNQMGERNAVESARRSYSRIGASFSVMIVVWMALVFVLGIGISMLHREAAHWMWVSLLV
FT                   SDCSFYLVAVPLAYLMLRSVPEEPTRKFGMTFGELFEWFLVSLAIVFVGGLLGNALAAL
FT                   FSGGMAQNRLDNIVGGIPAWLNILAVVVVGPIVEEWLCRKQIIARVRRYGERLAIVVSA
FT                   LVFALFHLNLYQFFYAFGLGLVLGYIYMRTSQLKYTIGLHMAINFLGSVVGPFFSDWSD
FT                   AHSAALDAGDVSGPELVVGVAAMLYILLYLVAVVAGVVLLIVKCRRLEFYVTPAQLPKG
FT                   TACSCAFVNAGMGVFITLTVFGMVLALMNVM"
     atgaccgaac cgggacgccc gcagagtccg caacagaaca cacgggcggg tgaattccag        60
     caggcgtggc agggcgagtt ccagcagccg cagtattggc aggaaccgca gcagaatcct       120
     tggcaggaac cgccgatgaa tcagatgggc gaacggaatg cggtggaatc cgcgcgcagg       180
     tcttactcgc gcataggggc gtcgttcagc gtgatgatcg tggtgtggat ggcgctcgtg       240
     ttcgtgctcg ggatcggcat tagcatgctg caccgcgaag ccgcgcactg gatgtgggtg       300
     tcgctgctcg tctccgactg ctcgttttac ctggtggccg tgccgctcgc ctacctgatg       360
     ctcaggagcg tgcccgagga gcccacgcgc aagttcggca tgaccttcgg cgaactgttc       420
     gaatggttcc tcgtgagcct ggccatcgtg ttcgtgggcg gactgctcgg caacgcgctc       480
     gccgcgctgt tctcgggcgg catggcacag aaccgtctcg acaacattgt cggcggaatc       540
     ccggcatggc tcaatattct cgccgtggtg gtcgtgggcc cgatcgtgga ggagtggctg       600
     tgccgcaagc agatcatcgc gcgcgtgcgc cgctacggcg agcggttggc aatagtggtg       660
     tcggcgctcg tcttcgcgct gttccacctg aatctgtacc agttcttcta cgcgttcgga       720
     ctcgggctcg tgctcgggta catctacatg cgcacaagcc agctcaaata cacgatcgga       780
     ttgcacatgg cgatcaattt cctgggcagc gtggtcggtc cgttcttcag tgactggagc       840
     gacgcccatt ccgccgcgct cgatgccggc gatgtgtccg gaccggaact cgtcgtgggc       900
     gtggccgcca tgctgtacat tctgctgtat ttggtggccg tggtcgcggg cgtggtgctg       960
     ctcattgtga aatgccgcag actcgagttc tacgtcacgc ccgcgcaact gccgaaaggc      1020
     actgcctgct cgtgcgcgtt cgtcaacgcc ggcatgggcg tgttcatcac gctgacggtg      1080
     ttcggcatgg tgttggcgct tatgaacgtg atgtag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page