(data stored in ACNUC30630 zone)

EMBL: CP001515.PE250

CP001515.PE250       Location/Qualifiers
FT   CDS_pept        310344..311996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0257"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45648"
FT                   /protein_id="ACS45648.1"
FT                   /translation="MAEQESALDFIEATHLWSQHAQFVGRAEGAPNPFRTIYGVEAQPG
FT                   GVWDVMTRFHTICERLQLPFHVSTSVEVNPATGDMAVAFGAPEPTQFPTAVPDSHGRAR
FT                   DCTGKRAQWTAAYALRLAALLANIGFAVNTGIIGVTVIARAGEPDGQTLFSLGFNRVDF
FT                   HFTTAKLFADGTIDDAQFDVDPAQLLAAFDVDSARVEFDADGWFAPTEDPELPESLCEL
FT                   RTPLGEDARELPDSLKSLLRADRVCDLDIADQASLSIRDIHQIAQENADSPVTAVVELG
FT                   GALTTLKQELSVSTSIRQPLYCEREALRLLVSEAAGDAATRYRTVPGAIAAVRSELARF
FT                   DMKLGQLDDALRELQELQRISPTSVQGGIAEAMAYSMAGDTARAVDAIRQALKLAVVPD
FT                   EVAFLYCLLGQMFAMAGETDTAIDAYYVASTVAAQTAYTGVARQAMEALLAQIGSADDD
FT                   GERDERSFTATVDARPTAPSRGHALGSLQAAGIPISPTQPVIQTLTRAAMLLADAGVPL
FT                   AAYDGVEILAEYSAEPTLLWMCRALQEGAGCAR"
     atggcagaac aagagagtgc gctcgatttc attgaggcga cgcatctgtg gtcgcagcac        60
     gcgcagttcg taggcagggc ggagggcgcg ccgaatccgt tccgcacaat ctacggcgtc       120
     gaagcgcagc cgggcggcgt gtgggatgtg atgacgcggt tccacacaat ctgcgaacgg       180
     ttgcaattgc cgttccacgt gagcacgagc gtcgaggtga acccggcgac cggcgacatg       240
     gcagtggcat tcggcgcgcc cgagccgacg cagttcccca ccgcggtgcc ggattcgcac       300
     ggtcgcgcgc gcgactgcac cggcaagcgg gcgcagtgga cggcggcata tgcgttgcgc       360
     ttggcggcat tgctcgcgaa catcggattc gcggtgaaca cgggaatcat tggtgtcacg       420
     gtgatcgcgc gcgccggcga accggatggc cagacgctgt tctcgctcgg gttcaaccgc       480
     gtcgacttcc atttcaccac ggccaagctg tttgcggacg gcacgattga tgacgcccag       540
     ttcgacgtcg accccgcgca gctgctcgcc gcgttcgacg tggacagcgc gcgtgtggag       600
     ttcgacgccg acggatggtt cgcgccgacg gaggatcccg agctgccgga gtcgctgtgt       660
     gaactgcgca cgccactcgg cgaggacgcg cgcgagttgc cggattcgct gaagagcctg       720
     ctgcgcgccg accgcgtgtg cgatctggac attgcagatc aggcgagcct gagcattcgc       780
     gacattcacc agatcgccca ggagaacgcg gattcgccgg tcaccgccgt ggtcgagctc       840
     ggcggggcgc tcacgacgct caaacaggag ctttcggtga gcacgtccat tcgccagccg       900
     ctgtactgcg agcgggaggc gttgcgattg ctggtctccg aggcggcggg tgatgcggcg       960
     acgcggtacc gcacggtgcc gggtgcaatc gccgcagtgc gctccgagct cgcgcgcttt      1020
     gacatgaagc ttggtcaact ggatgacgca ctgcgcgaac tgcaggaact gcagcgcatc      1080
     tcgcccacca gcgtgcaggg cggcatcgcc gaggccatgg cgtattcgat ggccggcgac      1140
     acggcccgcg cggtggacgc catccggcag gccctcaagc tcgccgtggt gcccgacgag      1200
     gtggcgttcc tgtactgcct gctcgggcag atgttcgcga tggcgggcga gaccgacacg      1260
     gcgatcgacg cgtactatgt ggcgtccacc gtggccgcgc agaccgcgta caccggcgtc      1320
     gcgcgccagg cgatggaggc gttgctcgcg cagattggct ccgcggacga cgacggcgag      1380
     cgggacgagc gcagtttcac cgcgacggtg gacgcgcggc ccaccgcacc gtcacgcggg      1440
     cacgcgctcg gctcattgca ggcggccgga atcccgatct cgccgaccca gccggtaatc      1500
     cagacgctca cgcgggcggc catgctgctc gccgatgccg gcgttccgct cgccgcctac      1560
     gacggtgtgg agattctcgc cgagtattcc gcggaaccga cgctgctgtg gatgtgccgc      1620
     gcactgcagg aaggcgccgg ctgcgcgcgc tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page