(data stored in ACNUC30630 zone)

EMBL: CP001515.PE255

CP001515.PE255       Location/Qualifiers
FT   CDS_pept        324931..325056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45653"
FT                   /protein_id="ACS45653.1"
FT                   /translation="MLATSWDELLLDADPMLDHHAQFAGAVLDFSRGNERFLTSN"
     atgctcgcga cgtcgtggga cgagctgctg ctggacgccg atccgatgct cgatcaccat        60
     gcgcaattcg cgggcgcggt gctcgatttc tcgcgcggca acgagaggtt cctcaccagc       120
     aactag                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page