(data stored in ACNUC30630 zone)

EMBL: CP001515.PE272

CP001515.PE272       Location/Qualifiers
FT   CDS_pept        complement(346937..347533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0279"
FT                   /product="Putative metal-binding/nucleic acid-binding
FT                   protein"
FT                   /note="COG1399 Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45670"
FT                   /protein_id="ACS45670.1"
FT                   /translation="MARIEYTDWTVPVAQVGSRAGQTMQVDRDFPAPGGIGDSIVGVKE
FT                   GEPIHVNGQFDSIIDGLIFTGTFTAPVTAVCARCDRDLSGDWSEQVTAFFPYEDADAGK
FT                   TKNEDVEIIAGEEESGDTYPLIDNGAFANIEPLLRDTFVSALPLNPLCKPDCKGLCPQC
FT                   GLDLNESPEHVHEVTDLRFADLEALKEQLEREQGE"
     atggcacgta ttgaatacac agattggacg gttccggtgg cccaggtcgg ctcgcgcgcg        60
     ggccagacca tgcaggtcga ccgtgatttc ccggcacccg gcggcatcgg cgactcgatc       120
     gtgggcgtca aggaaggcga accgatccat gtgaacggcc agttcgactc gattatcgat       180
     ggtctcattt tcaccggcac gttcacggcg ccggtcactg cggtgtgcgc gcgctgcgac       240
     agggatctga gcggggactg gagcgagcag gtcaccgcgt tcttcccgta tgaggatgcc       300
     gatgccggca agaccaagaa cgaagatgtg gagatcatcg ccggcgagga ggagtcgggc       360
     gacacgtacc cgctcatcga caacggcgcg ttcgcgaaca tcgagccgct gctgcgtgac       420
     accttcgtga gcgcgttgcc gctcaatccg ctctgcaagc cggattgcaa gggtctgtgc       480
     ccgcagtgcg gtctcgatct caacgagagt cccgagcatg tgcatgaggt gaccgacctg       540
     cgtttcgccg atctggaggc gctcaaagag cagctcgaac gcgagcaggg cgagtga          597
//

If you have problems or comments...

PBIL Back to PBIL home page