(data stored in ACNUC30630 zone)

EMBL: CP001515.PE28

CP001515.PE28        Location/Qualifiers
FT   CDS_pept        complement(31962..32285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0030"
FT                   /product="MazG nucleotide pyrophosphohydrolase domain
FT                   protein"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45426"
FT                   /protein_id="ACS45426.1"
FT                   /translation="MISDDTLRMIHQFSADRDWQQFHAPANMAKSVSIEAGELLECFQW
FT                   SDEPRDGDWEHVYEELADVMIYCIQMADVLDVDLDEIIRSKMAKNAKKYPVEASRGSSA
FT                   KAE"
     atgatctccg atgacacgct ccgcatgatc caccagttca gcgcagaccg cgactggcaa        60
     caattccacg cgcctgccaa catggcaaaa tctgtgagca tagaagcggg cgagctgctc       120
     gagtgcttcc agtggagcga cgagccacgc gacggcgact gggagcacgt gtacgaggag       180
     ctcgccgacg tgatgatcta ctgcatccaa atggccgacg tgctcgacgt cgacctcgac       240
     gagatcatcc gcagcaaaat ggcgaaaaac gccaagaaat acccagtgga agcaagccgc       300
     ggctccagcg cgaaagcgga gtga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page