(data stored in ACNUC30630 zone)

EMBL: CP001515.PE308

CP001515.PE308       Location/Qualifiers
FT   CDS_pept        396679..397125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0318"
FT                   /product="putative holo-[acyl-carrier protein] synthase"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45706"
FT                   /protein_id="ACS45706.1"
FT                   /translation="MMLGLGHDVVDVGAFAEQLEMPGTRMTRLFSARECRQASLRASIK
FT                   HDGEALHLAAKWAAKESVVKAWCEALVGRGITERPYTVDDTPWSRIEIVDDATGCPRVV
FT                   MAAEVHVELCRSLAVTESAEPVWHVSISHDGGIASAVAVLDMRE"
     atgatgctcg gtctggggca cgatgtggtc gacgtcggcg cgttcgcgga acagctcgag        60
     atgccaggca cgcgtatgac gcggctcttc tccgcgcgcg agtgccggca ggcgagtctg       120
     cgcgcgtcga tcaagcacga cggcgaggcg ttgcatctgg cggcgaagtg ggcggcgaag       180
     gagtctgtgg tcaaggcgtg gtgcgaggca ctcgtcggcc gtggaatcac cgagcgccca       240
     tacacggtgg acgacacgcc atggtcgcgc atcgagatcg tcgacgacgc cacagggtgc       300
     ccacgcgtcg tcatggcagc ggaagtccat gtcgagctgt gccgctcgct ggcagtgacg       360
     gaaagcgctg agccggtctg gcacgtgtcg atttcgcacg acggcggcat cgcatcggcg       420
     gtagccgtgc tcgacatgcg ggagtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page