(data stored in ACNUC30630 zone)

EMBL: CP001515.PE321

CP001515.PE321       Location/Qualifiers
FT   CDS_pept        412971..414176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0332"
FT                   /product="hypothetical protein"
FT                   /note="COG1496 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45719"
FT                   /protein_id="ACS45719.1"
FT                   /translation="MSEQEQHTDEQNANAAPKPMQINLDDLLKAVQAHGQKTVEQEDKA
FT                   AREGGKDADGKTYDDAILDSSAIEPTDDEGNPIPVTIPVVLSPGITVIYTTRLGGVSAE
FT                   EWAHFNLGGKSGDDPVAVERNREALADELHVKLSLIDQVHSGKSVDIDEVYTENKPFGF
FT                   DASGSHTEAQAKAKRAGEPVVDDVESENAEVQVIEGDAQVTCRKDIAIGVFAADCLPVL
FT                   FADPQAGVVAAAHCGRKGLQRNVIAATVDMMVKKGASKENIVATLGPAICGDCYEVGDQ
FT                   IADEFDAQFPGTFTLTRFGGPGIDLNKAALMELHQAGIKDDRIFSSQPRVNAATQYLSQ
FT                   DAELEELCREDNEGDPALEERIKGIRYSMCTLENPLWFSHRRAELAHKRHEGRMLALIV
FT                   RS"
     atgagtgaac aagaacagca tacggatgaa cagaacgcga acgcggcacc caagccgatg        60
     cagatcaatc tcgatgacct gctcaaggcg gtgcaggcgc atgggcagaa gaccgtggag       120
     caggaagaca aggccgcacg cgaagggggg aaggacgccg acggcaagac ctatgacgat       180
     gccattctcg acagctcggc catcgaaccc accgacgacg agggcaaccc gattccagtg       240
     acgattccgg tggtgctctc gcccggcatc accgtcattt acaccacccg tctgggaggc       300
     gtgagcgccg aggaatgggc gcacttcaat cttggaggca agtccggcga cgaccccgtt       360
     gctgtggagc gcaaccgcga ggcgcttgcc gacgaactcc atgtgaagct ctcgctcatc       420
     gaccaggtgc attcgggcaa gtcggtggac atcgacgagg tctataccga gaacaagccg       480
     ttcggtttcg acgcatccgg ttcccatacc gaggcccagg ccaaggcgaa gcgtgcgggc       540
     gagccggtgg tggacgacgt tgagtccgag aacgccgaag tgcaggtgat cgagggcgat       600
     gcccaggtga cctgccgcaa ggacatcgcc attggtgtgt tcgccgcgga ctgcctgccg       660
     gtgctgttcg ccgacccgca ggccggggtc gtcgccgccg cacactgtgg gcgtaagggc       720
     ctgcagcgca atgtgatcgc cgccaccgtc gacatgatgg tgaagaaagg tgcctccaag       780
     gagaacatcg tcgccacgct cggcccggcc atctgcggcg attgctacga ggtgggcgac       840
     cagatcgccg acgaattcga cgcgcagttc ccgggcacct tcacgctgac ccgcttcggc       900
     ggccccggca tcgacctcaa caaggcggcg ctgatggagt tgcaccaggc cgggatcaag       960
     gacgaccgca tcttctcctc gcagccgcgc gtcaatgccg ccacgcagta cctgtcgcaa      1020
     gacgccgagc tcgaggagct gtgccgtgag gacaacgagg gagacccggc gcttgaggag      1080
     cgcatcaagg gcattcgcta cagcatgtgc acgctggaga acccgctgtg gttctcgcat      1140
     cgccgcgccg aactcgccca caagaggcat gagggccgca tgctggcgct cattgtgcgt      1200
     tcctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page