(data stored in ACNUC30630 zone)

EMBL: CP001515.PE324

CP001515.PE324       Location/Qualifiers
FT   CDS_pept        415868..417586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0335"
FT                   /product="hypothetical protein"
FT                   /note="COG3599 Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45722"
FT                   /protein_id="ACS45722.1"
FT                   /translation="MVDRFPVVLRGYDKERVDEAMLAAQNSIDRLREQVKAGDDTVLQL
FT                   QAQLQEEKNRKANTDNSFASLGANAQQMLASAEQTSTELLERAKKDAASARTEAQSQSQ
FT                   TLVNNAKLDAQHLVDDAQAKADTILKNAQSEANTIVTNARQEAEQLRASTAKTVSDQRQ
FT                   ALDLELTNSREEHKKRLASERAQQERELADLSAQTAKTISEQRKSANEEMARLKSETND
FT                   QIETALADANKKLADVREQVSKLMTEAQRKAGEITDAAKAHAQEITDAAEVNRTQTMSQ
FT                   VNAEVEQIRADIAAQQDEATKKVQELLQSLEESRKSAKEEAEKEIGQAKQAREEADAYA
FT                   AEKRESADTEAREIVRKAGEEASKQIEDRRKAAQSELDGLRKRIGELQTREADITQRVS
FT                   ELRSMFANAFAGFGFGIDKHSTDTMSVVNTVAGDNDSSDTPQAPADNGSVRSDLANTML
FT                   INPSDSAQHEASHPMSHVTVPVAPALHDHAAQANAADDDNAGTNDEAQVPAVDIPADPN
FT                   TPSPEAPEAPAASAAEVMEAIDGDEPISDDTHVTGDADSLFDSSDNMPVAPNNEQ"
     atggtggatc gtttcccggt agttctgcgc ggctacgaca aggagcgcgt ggacgaggcg        60
     atgctggcgg cacagaacag catcgaccgt ttgcgcgaac aggtgaaggc aggcgacgac       120
     acggtgctgc agctgcaggc gcaactgcag gaggagaaga accgcaaggc gaacaccgac       180
     aactcgtttg cctcgctggg cgccaacgcc cagcagatgc tcgcctccgc cgagcagacg       240
     agcaccgagc tgctcgaacg tgccaagaag gacgcggcct ccgcgcgcac ggaagcgcag       300
     tcgcaatccc agacgctcgt gaacaacgcc aaactcgacg cccagcacct ggtcgacgac       360
     gcgcaggcga aggccgacac cattctcaag aacgcgcaga gcgaggcgaa caccatcgtg       420
     acgaacgccc gtcaggaagc cgagcagctg cgcgcctcca ctgcgaagac ggtgagcgac       480
     cagcgtcagg cgctcgacct cgagctgacg aactcgcgcg aggagcacaa gaagcgcctc       540
     gcctccgaac gcgcccagca ggagcgtgag ctcgcggatc tgagcgcaca gaccgccaag       600
     acgatctccg agcagcgcaa aagcgcgaac gaggagatgg cgcgactcaa gagcgagacg       660
     aacgaccaga ttgagaccgc gctcgccgac gccaacaaga aactggccga tgtgcgcgag       720
     caggtgtcga aactcatgac cgaggcgcag cgcaaggccg gcgagatcac cgatgccgcc       780
     aaggcgcatg cgcaggagat caccgatgcc gccgaggtga accgcacgca gacgatgagc       840
     caggtgaatg cggaggtgga gcagattcgc gccgacatcg ccgcccagca ggatgaggcg       900
     accaagaagg tgcaggaact gctgcagagc cttgaggaaa gccgcaagag cgccaaggag       960
     gaggccgaga aggagatcgg gcaggccaag caggcccgcg aggaggccga cgcctacgcc      1020
     gccgagaagc gcgagtcggc cgacaccgag gcccgtgaga tcgtgcgcaa ggccggcgag      1080
     gaggcctcca agcagatcga ggaccgtcgc aaggcggcgc aatccgagct cgatgggctc      1140
     cgtaagcgca tcggcgaact gcagacccgt gaggcagaca tcacgcagcg cgtctccgaa      1200
     ctgcgctcca tgttcgccaa cgcctttgca ggcttcggct tcggcatcga caagcattcg      1260
     accgacacga tgtcggtggt caacaccgtc gctggcgaca acgactcttc ggacactccg      1320
     caggccccgg ccgacaacgg cagcgttcgc agcgatctgg cgaacaccat gctcatcaat      1380
     ccctccgatt cggctcagca tgaggcctcg cacccgatgt cgcacgtcac ggtgccggtc      1440
     gccccggccc tccacgatca cgcagcacag gcgaacgcgg cggacgacga caacgccggc      1500
     acgaacgatg aggcgcaggt tccggcggtg gacattccag cggatccgaa cacgccgtcc      1560
     ccggaggcac cggaggctcc cgctgcgtcg gcagccgagg tgatggaggc cattgacggc      1620
     gacgaaccga tcagtgacga cacccatgtg accggcgacg cggattcgct gttcgattcg      1680
     agcgacaaca tgccggtggc gccgaacaac gagcagtga                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page