(data stored in ACNUC30630 zone)

EMBL: CP001515.PE34

CP001515.PE34        Location/Qualifiers
FT   CDS_pept        37469..39892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45432"
FT                   /protein_id="ACS45432.1"
FT                   /translation="MGSGELQTWNGHFDRGVYIDYTLEPLQSERHIEGTKDEASQSGSR
FT                   IDEDTTIEIEDIEEENNSDQDESHRVDYMLAAGCGIISGAIDSLWVGKFDFDRAREWGS
FT                   ERVNEFVMAVAKMDPEYKGDDVKSAIRFLEKKYPFVGDRATSEFGGGRQHHLRDFSHHM
FT                   SLGGLAFSLLTQFTGKVYGTDQHGVFMVVPVADEELIGKTIEEKLMLGAVRWFFHMVSD
FT                   MAGSSGSAGKGTGIPGPILSLMKQLSALPLFKDAMTDEALFRKMLSKLFNGTLLKTVDE
FT                   EGKKIYRRFDLRAELGIAHELARQSVPVLVNECLVCVCYAARRLYTMCSNGEVHDFKSL
FT                   LSVGLDALLPHGSPLGTRMVTIATGVFSVVDMTDGAIRTLMRSGGKLNPGMVSDFLLHV
FT                   NVVGVVRFVFAVHTDYKVHAKAKRETRLQAKFHGRGNGYGDDASVMRFFELDMAQANMV
FT                   VSIEYQAARLDIEQTKNKKTREEKEREFSDWENDNCSEFILRDKEALVNEIHRIQRYAT
FT                   PVWQKLVALEASQFMPYQSKKLKYDAATLDMVCSDLPGFEDKECTKYRKAVIKETSAIK
FT                   GVKKAVLAGCVGIGVVAVATGGAAYVFAPAIAPILAGPSVAGLSGAALTSASLAAVGGG
FT                   SLAAGGLGMSGGVALIAGGGALLGAVTGGGAATLGTWVLANQDAYVLNTCAKLIVFCRD
FT                   VLMEIDGGVELVRQVRQSVCEQLRETEPQLDFLGQLKQFIKQSGSRDADSDPSAKRERS
FT                   EALKGIDKSEKNMKRSVKYMRKCVKELGKVTGITDENRGASGAQWKPVAQIEKG"
     atgggcagtg gagaattgca gacgtggaat ggacacttcg ataggggagt gtacatcgat        60
     tacactctcg agcctttgca atccgagcgt cacatagaag gcaccaaaga tgaagcctcg       120
     cagtccggaa gccgaattga tgaagataca acgatcgaaa tagaggatat cgaggaagaa       180
     aacaatagcg atcaggatga atctcatcgt gtggattaca tgcttgctgc cggctgtgga       240
     atcatctctg gcgctattga ctcattgtgg gtggggaagt ttgatttcga tcgcgctcgc       300
     gaatggggaa gcgagcgtgt caatgagttt gtgatggcag tcgcgaagat ggatccagag       360
     tataaaggcg atgacgtaaa gtcggcaatt cgttttctag agaagaagta tccatttgtg       420
     ggagatcgtg caacaagtga gttcggtggt ggtcgtcagc atcatctcag ggatttctcg       480
     catcacatga gcttgggtgg tcttgcgttt tcattgctga cgcagttcac cggaaaggtg       540
     tatggcaccg atcagcacgg tgtctttatg gtcgtgcctg ttgcagatga ggagctcatc       600
     gggaaaacta tagaagagaa gctcatgctc ggtgctgtgc gttggttctt ccatatggtg       660
     agcgatatgg cgggttcgag tggatcagcg gggaagggga ccggtattcc agggccgata       720
     ctttcgttga tgaagcagct atccgcgctt cctctgttca aggatgcgat gactgatgag       780
     gcgttattca ggaagatgct gtccaaactg ttcaacggaa cgttgctcaa gaccgtcgac       840
     gaagaaggaa agaaaatcta ccgacgcttc gatttgcgag cggaattggg aatcgcgcat       900
     gaacttgcta ggcagtcggt gccggtgctg gtcaacgaat gccttgtctg cgtatgctat       960
     gcagcccggc gactgtatac aatgtgctcg aacggggaag tgcatgattt caagtcattg      1020
     ctgagcgttg ggcttgacgc attgttgcca cacggttcgc cattgggtac gcggatggtc      1080
     accatagcga ctggggtgtt ctctgttgtc gatatgacgg atggggcgat tcgcacgctg      1140
     atgcgtagcg gagggaagct caatccggga atggtgtcgg atttcctgct acatgtaaat      1200
     gtggtgggcg tcgtgcgatt cgtcttcgcc gtgcatacgg attacaaggt acatgcgaaa      1260
     gcgaagagag agactcgttt gcaggcaaag tttcacgggc gaggaaacgg ctatggcgat      1320
     gatgcctcgg tcatgcgatt cttcgagctg gatatggcgc aggcgaatat ggtggtttcc      1380
     attgagtatc aggcagctcg cctcgacatt gaacagacga agaacaagaa gacaagagag      1440
     gagaaggaac gggagttcag cgattgggag aacgataatt gctctgaatt catattgcgc      1500
     gacaaagaag cactcgtaaa tgaaattcat cgaattcaga ggtatgctac tccagtctgg      1560
     cagaaactcg tggcattgga agcttctcag ttcatgccgt atcagagcaa gaaattgaaa      1620
     tacgatgcgg cgacgctgga tatggtgtgc agtgatctgc cggggtttga agataaggaa      1680
     tgcaccaaat acagaaaagc tgtgattaag gagacgtcgg caatcaaagg tgtgaagaaa      1740
     gcggttctag ccggttgtgt cggaatcggg gttgtagctg ttgcgacggg aggggctgct      1800
     tatgtgttcg caccggcgat tgcgccaatc ctagctggac cttctgtggc cggattgtcg      1860
     ggagctgctt tgacgagcgc aagtcttgct gcggtgggag gcggctcgct ggcggcaggt      1920
     ggtcttggaa tgtcgggagg cgtagccctc attgcaggag gtggcgcatt gctgggggct      1980
     gttactggcg gtggcgcggc aacgttgggc acttgggtgc ttgcaaatca agacgcatac      2040
     gtgctgaaca cctgcgcaaa actgatagtg ttctgcaggg atgtactgat ggaaatcgac      2100
     ggtggtgtgg aactcgtgcg tcaggtgcgg cagagtgtgt gcgagcagct acgggaaact      2160
     gagcctcagc ttgacttctt ggggcagctc aagcagttca taaagcaaag cggtagcaga      2220
     gatgcggatt cggatcctag cgctaaacgc gaacgttctg aggcgctgaa gggaatcgac      2280
     aaaagtgaaa agaatatgaa gagaagcgtg aaatacatgc ggaaatgcgt gaaagagctc      2340
     ggaaaggtca caggaatcac agatgagaat aggggtgcat ctggggctca atggaagccg      2400
     gtagctcaga ttgagaaagg ctga                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page