(data stored in ACNUC30630 zone)

EMBL: CP001515.PE341

CP001515.PE341       Location/Qualifiers
FT   CDS_pept        437078..440725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0352"
FT                   /product="hypothetical protein"
FT                   /note="COG1112 Superfamily I DNA and RNA helicases and
FT                   helicase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45739"
FT                   /protein_id="ACS45739.1"
FT                   /translation="MSSMSNTDTPETKAPTSGSIDKLRRWRDEYRASLMASPLEDVNQL
FT                   SAKLDLTHAHPSGISQLFASGSAPLHSLFRDSGMLRAAARRTERVLDDQSAKKRISGVA
FT                   ELSLVVGVATWKGNKMPVLLYPVEVVRDGTPVENHTTITFTGHVRLNSAFLNAMRENGV
FT                   NLDERALFDGSNYASGTPETAAVFAVITKAAQQVFADFSIERQIILGCFVDPSTQILME
FT                   SRMIIERLARGPINNVMLNALAGYPEAIEQLSRITLPPYSPFDGDPHSEYEVGDVDNTV
FT                   RYAANVAAAGHSLFVDGTLGNDTAEQAASIASRCIMAGRSVLYVPCVTSQKRTFAMLMK
FT                   ANELGEQLLDVANPNANAAIDHQLISAVGYQQGVATSRFEQLADELVGVRSRLTRYLGD
FT                   LHGVNQTWGVSAYQTIQNLASISELPAHPMTRVRLTKECALAIGKSLDEWAKKLERAGE
FT                   LGEYSVGPDDTAWYGASLYSEEEAIDAYQRVVNVLRSLLPATREQVTTTVKVCGFSIPQ
FT                   TADEWSKQVTVLKNLRRVLDVFQPEIFERDIDAMIEATESKQERKTSDSQMGFWDRRRH
FT                   IKEAKSMLRVGAQVEDLHEALLVVKRQGEQWRLFVPHGGWPVLPPKLDDIIATQEQLMS
FT                   NLTALDTVLATTPAGAELQQQDFNALEERLKALFDDRKALDTLPERCVIERELKRAGLG
FT                   ELVDDLRERKVKVDAVSNELRLAWWTTVFDDIVHSSAIISNQDGSALQAASDRFVQVDV
FT                   EHVRSIGPMIMQESMRRLCDLLFSRTQEANMMHTALAGASSISLSRIHQDHPEILAAAK
FT                   PVIMATPATLAAVTNPTPIADVVIIDAAAHLPSVLLLSILCRARQVVILAHRSTVTSEG
FT                   IGMLMSMLPNISVASHPTRRDPRVNRFLEEQGYGKVNTDVVREPMQGHIRFHKIEAAGV
FT                   PLMASGLVESSQQEIAEVVRLITQRAQTFTLVPPSYLLTVVCLTSTFRTRLGAELRSLA
FT                   AKSEAMGRFLRHVRIVDIADVAGARATDVILSMSYAKTTHGRLLQQFGVLENNGGRGML
FT                   LDALALCDHHLDIVSAFGASDLDDDRLHQDGPKMLKVLLQWAEDLDEANVVRPAIKQTD
FT                   ENVLFNDLATRIRERGLNVAVDYGYDGGMKLPMVVGLKDKPFALAVFTDDAQFMGMQST
FT                   RERHRILPQEIESLGWSVMTIWSVGAFVNPEKEVDRVVARLGEIYQDKQ"
     gtgagctcga tgtcgaacac cgatacacca gaaacgaagg cccctacgag cggttccata        60
     gacaagttgc gccgctggcg tgacgaatac agggcgagcc tcatggcctc gccgttggag       120
     gatgtgaacc agctgagcgc caagctcgac ctgacccatg cgcacccctc gggcatctca       180
     cagctgttcg ccagcggaag tgccccgttg cattcgctgt tccgcgacag cggcatgctg       240
     cgcgcggcgg cacggcgtac cgagcgtgtg ctcgacgacc aaagcgccaa gaagcgcatc       300
     agcggcgttg ccgagctctc cctggtggtg ggcgtggcca cgtggaaggg caacaagatg       360
     ccggtgctgc tctacccagt cgaggtggtg cgtgacggca ctcccgtgga gaaccatacg       420
     acgatcacct tcaccggtca tgtgcgcctg aactcggcct tcctcaatgc catgcgcgag       480
     aacggtgtga atctcgacga gcgcgcgctg ttcgatggct cgaactatgc cagcggcacg       540
     ccggagacgg ctgcagtatt cgcggtcatc acgaaggcgg cgcaacaggt gttcgccgac       600
     ttctcaatcg aacggcagat cattctcggc tgcttcgtcg acccatccac acagatcctc       660
     atggaaagcc gcatgatcat cgagcggctg gcacgtggtc cgatcaacaa tgtcatgctc       720
     aatgccctgg ccggctaccc ggaagccatc gagcaacttt cgcggatcac ccttccaccg       780
     tatagcccct tcgacggcga cccccactcc gaatacgagg tgggcgatgt cgacaacacc       840
     gtgcgttatg ccgccaacgt ggcggccgcc ggccattcgc tgttcgtcga cggcacattg       900
     ggcaacgaca ccgccgagca ggccgcgtcg atcgcctccc gttgcatcat ggccggccgg       960
     tccgtgctct acgtgccatg cgtcacctcg cagaagcgca cattcgccat gctcatgaag      1020
     gccaacgaat tgggcgagca attgctcgac gtggccaacc cgaacgccaa tgcggccatc      1080
     gaccaccagc tcatcagcgc ggtgggatac cagcagggcg tcgccacctc gcgtttcgaa      1140
     cagctcgccg atgaactcgt gggcgtccga tcccgcctca cccgctatct gggagacctg      1200
     cacggcgtga atcagacgtg gggcgtctcc gcataccaga cgattcagaa cctcgccagc      1260
     atctccgaat tgccggcgca cccgatgacc cgcgtacgcc tcacgaagga atgcgcgctc      1320
     gccataggca aatcgctgga tgagtgggcc aagaagctcg aacgtgccgg cgaactcggc      1380
     gaatactcgg tggggcccga tgacaccgca tggtacggtg cgtcgctcta cagcgaggag      1440
     gaggccatcg acgcctacca acgcgtggtg aacgtgctgc gatccctgct gccggccacg      1500
     cgtgaacagg tcaccaccac cgtgaaggtg tgcggcttct cgattccgca aaccgccgat      1560
     gagtggagca agcaggtcac cgtgctcaag aacctgcgcc gtgtgctcga cgtgttccag      1620
     cctgagatat tcgagcgtga catcgatgcg atgatcgagg ctacggagtc gaagcaggag      1680
     cgcaagacga gcgattcgca gatgggcttc tgggatcgtc gcaggcacat caaggaagcc      1740
     aagagcatgc tgcgcgtggg cgcccaggtg gaggacctgc acgaggcatt gctggtggtg      1800
     aagcgtcagg gcgagcagtg gcgtctgttc gtgccgcatg gcggctggcc ggtgctgccg      1860
     ccgaagctcg acgacatcat cgccacccag gaacagctca tgagcaatct aacggccctt      1920
     gacaccgtgc tggccaccac gccggccggg gcggagctcc agcagcagga cttcaacgca      1980
     ctggaggaac gtctcaaggc cctattcgac gaccgcaagg ctctcgacac cctgccggaa      2040
     cgttgcgtga tcgaacgcga gctcaagcgc gccggtctcg gtgagctggt ggacgaccta      2100
     cgtgaacgca aggtcaaggt ggacgccgtg agcaacgagc tcagactggc atggtggacc      2160
     accgtgttcg acgacatcgt gcattcctcg gccatcattt cgaaccagga cggctcggca      2220
     ttgcaggcgg cctccgaccg cttcgtgcag gtggatgtgg agcatgtgcg ctccattggc      2280
     cccatgatca tgcaggaatc gatgcgcagg ctgtgcgacc tgctgttctc ccgcacgcag      2340
     gaggccaaca tgatgcacac ggccctcgct ggtgcgtcga gcatttcgtt gagccgcatc      2400
     catcaggacc atccggagat tctcgctgcc gccaaaccgg tgatcatggc cacgccggcc      2460
     acgctcgctg ccgtgacaaa tccgacgccc attgccgacg tcgtgatcat cgatgccgcg      2520
     gcacacctgc cgtcggtgct gctgctcagc attctgtgcc gtgcacgtca ggtggtcatc      2580
     ctcgcgcatc gcagcacggt gaccagtgag ggcatcggca tgctcatgtc aatgctgccg      2640
     aacatctcgg tagcctctca ccccactcgc cgtgatccgc gcgtgaatcg tttcctcgag      2700
     gaacagggct acggcaaggt gaacaccgat gtcgtgcgtg aaccgatgca gggccatata      2760
     cgcttccaca agatcgaggc cgcgggcgta ccgctcatgg ccagcggact cgtggaaagc      2820
     agccagcagg agattgccga agtggtgcgc ctcatcaccc agcgcgcgca gaccttcacc      2880
     ctcgtgcctc cgagctattt gctcaccgtc gtgtgcctca cctccacgtt ccgcacccgc      2940
     ttgggagccg aactgcgctc cctggcggcg aagagcgagg cgatgggtcg attcctgcgc      3000
     catgtgcgca tcgtcgacat cgccgatgtg gccggcgccc gcgccaccga cgtgatcctg      3060
     tcgatgagct atgccaagac cactcatggt cgcctgctcc agcagtttgg cgtgctcgag      3120
     aacaacggcg gccgtggcat gctgctcgat gcactcgcat tgtgcgatca ccatctcgac      3180
     attgtcagtg ccttcggagc cagtgacctc gacgacgatc gtctgcatca ggacggcccc      3240
     aagatgctca aggtgctgct gcagtgggcc gaggacctcg acgaggccaa tgtggtgcgt      3300
     ccggcgatta agcaaaccga cgagaacgtg ctgttcaacg atctcgcgac ccgcattcgg      3360
     gaacgcggtc tcaatgtggc tgtcgactat ggctatgatg gcggcatgaa gctgcccatg      3420
     gtcgttggtc tcaaagacaa gccgttcgcg ctggctgtat tcaccgacga cgcccagttc      3480
     atgggcatgc agtccactcg ggagcgtcac cgcattctgc cgcaggagat cgaaagcctc      3540
     ggctggtccg tcatgaccat atggagcgtc ggcgcctttg tgaaccccga gaaggaagtg      3600
     gaccgtgtgg tcgcacgtct cggcgagatt taccaggaca agcagtga                   3648
//

If you have problems or comments...

PBIL Back to PBIL home page